SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006377 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006377
Domain Number 1 Region: 349-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.35e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 254-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000165
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006377   Gene: ENSORLG00000005060   Transcript: ENSORLT00000006378
Sequence length 422
Comment pep:novel chromosome:MEDAKA1:17:5911889:5913902:-1 gene:ENSORLG00000005060 transcript:ENSORLT00000006378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKSKRAHSYHQPRYPDDDGGPLDAILAHVCAGEFGSSVEQQEDVSGRADSLSLS
PGTRLRSPGSLSSSSPLSCAGSAGSACERSSDCDFWRPPSPSSSPASKLITCLELCHIYY
YPAVFLLCFFHVIFDTNRKIRFVTNTCAYWILFPKKNPVMKLCAEACDPPALTRHPRALG
GSQPPAGMFGGEESSGERLYAQRGLAAGGLRDYSPTGRQLCRLRDGDALCGNVRPQSRKI
KAEDDFLHLEANGSYKCIKCIKVFSTPHGLEVHVRRSHSGTRPFECGICGKTFGHAVSLD
QHRAVHSQERSFSCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTF
IHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHKETQHE
LK
Download sequence
Identical sequences H2LK28
ENSORLP00000006377 ENSORLP00000006377 8090.ENSORLP00000006377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]