SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006437 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006437
Domain Number 1 Region: 133-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000038
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006437
Domain Number - Region: 167-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00504
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 77-132
Classification Level Classification E-value
Superfamily An insect antifreeze protein 0.0759
Family An insect antifreeze protein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006437   Gene: ENSORLG00000005107   Transcript: ENSORLT00000006438
Sequence length 204
Comment pep:novel chromosome:MEDAKA1:11:10649518:10656170:-1 gene:ENSORLG00000005107 transcript:ENSORLT00000006438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTDPRVLEKQEQQQPTYLALSYINRFMTDAARREQETMKKKATPKLSLSITGGMSRNSTA
TPPRHTSGNLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSES
ILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKT
SQGLRHHTINFHPPVSTEMLRKIQ
Download sequence
Identical sequences H2LK86
ENSORLP00000006437 8090.ENSORLP00000006437 ENSORLP00000006437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]