SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006453 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006453
Domain Number 1 Region: 161-423
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.14e-90
Family Eukaryotic proteases 0.0000641
Further Details:      
 
Domain Number 2 Region: 66-168
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-17
Family Hepsin, N-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006453   Gene: ENSORLG00000005115   Transcript: ENSORLT00000006454
Sequence length 427
Comment pep:novel chromosome:MEDAKA1:13:10737036:10740231:-1 gene:ENSORLG00000005115 transcript:ENSORLT00000006454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVRLLAAVCAVGLLGGVVVGVWFLVKLLMRPSSSQTPVGLGDTKETPFCNVTEDVSITDP
RKASVFYRISPENSLLEIQMEKLPTWLPVCYDRWNSSLGTLVCKQLGYLRLTKHKGVKLT
DIGPNYTDGFIQITAEHRSSLESLWQFRRSCSTGKVIALQCFECGTRAKLPRIIGGAEAA
LGRWPWQVSLYYSSRHTCGGSIITRQWIVTAAHCVHNYRLPQVSSWVVYAGIVTRSSAKM
VQHTGHAVEKIIYNKNYNHRTHDSDIALIKLRTPLNFTDTIRPICLPQYKYDLPGGTQCW
ISGWGYTKPDDGETVLPQVSIPIRVQSPDTLKEAPVPLISTKKCNSSCMYNGEITPRMLC
AGYTEGKVDACQGDSGGPLVCQEDTVWRLVGVVSWGTGCAEPNHPGVYTKVAEFLSWIYE
MIEVKAF
Download sequence
Identical sequences H2LKA2
8090.ENSORLP00000006453 ENSORLP00000006453 ENSORLP00000006453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]