SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006492 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006492
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily POZ domain 1.02e-30
Family BTB/POZ domain 0.0009
Further Details:      
 
Domain Number 2 Region: 610-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000742
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006492   Gene: ENSORLG00000005151   Transcript: ENSORLT00000006493
Sequence length 678
Comment pep:novel chromosome:MEDAKA1:1:16481345:16483761:1 gene:ENSORLG00000005151 transcript:ENSORLT00000006493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPGHFEQIFQQLNYQRLHGQLCDCIIVVGSRHFKAHRSVLAACSTHFRALFTVAEGDA
SMNMIQLDSEVVTAEAFAALVDMMYTSTLMLGESNVMDILLAASHLHLNNVVKACKHYLT
TRTLPVSPSSERRNAATSKVQRSFLLQQLGLSLVSSALGGMEEGGVSNRAVDQRASFPVR
RFHKRKPSLALTISEERPRQRQRTSGGANLGLLEEDGENADQDEAALHSPDSHKPGDDSK
LGAGITGFVAVAQDDPQMPSQSDSGRSEGENSVRIPGGVNKEEDMGDQDQQASRATVKIK
SGNEEEQGEDEERKVVVKREVLSSPEPVDENSDVTSQAEGSDPAEPGCQEEEEKVELSPE
GSDRSFTSDPQPSSESLLHSSSHNNGLSSSSNFNISNFLSSKDFGRGGSGLVSGEDDLPN
TTTGEAVAHRFLMRHDAAGPSSSASSSLIQSGTLSGESRNGFGDNLQPDSLFLQPPYENL
GGLRGSSGSAGRGGVDPFALDFQRSSLGLHSLGRPSRGMGSASASTLSYPSYRRIAPKMN
SGIGGEGRVQDPASPSSNLTSPLLLNESGGYEMNGGRPTSLPPQLTRASADVLSKCKKAL
SEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKH
SKTTCLRWQNMNMSNSLL
Download sequence
Identical sequences H2LKE1
ENSORLP00000006492 8090.ENSORLP00000006492 ENSORLP00000006492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]