SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006500 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006500
Domain Number 1 Region: 6-263
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.18e-86
Family Eukaryotic proteases 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006500   Gene: ENSORLG00000005158   Transcript: ENSORLT00000006501
Sequence length 266
Comment pep:novel chromosome:MEDAKA1:4:8863398:8866807:-1 gene:ENSORLG00000005158 transcript:ENSORLT00000006501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APFLAYLFCALFVHILVTSCPDCGLRPALGPQKIVGGVTARKGEWPWIGILQHQRLYRCG
ATLIHNKWLLTAAHCFKRYYNVNAYWAVSLGSVLRSGAGALVIPIQRVIIHPEFNGTRMD
HDVALLELAVPAPMSYTIQTACLPSPVHSFLQNAECYIAGWGSMKEGGSLANLLQKAEVK
IIEQADCQLSYGDALTQNMMCAGLMEGGRDTCLGDSGGPLTCRDLSGRWFIAGVTSWGHG
CGRVGFPGVYTRVTSVRKWISKYLPF
Download sequence
Identical sequences H2LKE9
ENSORLP00000006500 ENSORLP00000006500 8090.ENSORLP00000006500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]