SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006520 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000006520
Domain Number - Region: 447-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0715
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006520   Gene: ENSORLG00000005173   Transcript: ENSORLT00000006521
Sequence length 1067
Comment pep:novel chromosome:MEDAKA1:7:9666381:9689913:-1 gene:ENSORLG00000005173 transcript:ENSORLT00000006521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQPKGCSDEEDNSEEPEVPVGSQDGTYHNDKEAEDRPAKDDNYTPSTETHAGEASVLRD
YAATTMNEFLGMFGYDDQQVRDELTKKISFEKLKAATSDPSSLSSDEATRRARFSKYEEY
IRKLKAGETLPWPMHASPPKPDDLNTKLSQTSGCPPGTEGQIYPSSMDHKQQVAPQLSNS
RPTNPSHMQNMAPRASKYDFFIQKLKMGESLQQQNGNAYKRPSKYDLENVKFLHLFKPGE
GNPDMGGAIAFKTGKVGRPSKYDIRPIQKLMPGNPEASLMPNVLASAPGNPGAPGIPAVG
AVGASIAPGLTMDQSGSLNFSAADYLKSSFSKTDSITTGTVSSVKNGLPPDKPTTDDVNL
YQKYIARFSGSQHCGHVHCAYQYREHYHCMDPDCNYQRFTSKQDVIRHYNMHKKRDNSLQ
HGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCSKVYTSTSDVMTHENFHKKNAQLIN
DGFQRFRATEDCGTVSCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKD
GFKKFYKYEECKYEGCVYSKATNHFHCIRSGCGFTFTSTSQMTSHKRKHERRHIRSSGVM
SLSSTFLAPKDEQEESSNDDLMDFSAISSKNSSLSASPTTQQSTTVPHLLTTPTTAVSSS
SMSGHTLKPTSSLPTTGQRMSSLLSQTLPSNVPVALALSNNALAASNPFFPLMPRLPLQQ
TPPAASLISGTSSGAHSMPTDSLTQGCSTVGGDATMASTPTSFATSSIMEKISASKGLIS
PMMARLAAAALKPSSNQETGNGQPTSASQFNLVQVKQEPVEVNSGASQDSQEYSLDLSKK
DHSNESNGHPVPGNTSLLSSLMNKMSQTNPALFSAMNLKSELEGGQGNDTSEAAQYLNRV
LKRPQPEKPTEIWRTYLRRFDTDDFCEARCDFLKKVHFHCLIEDCGALFSTVDGAIKHAN
FHLRATMKVKSEPPFTDDKEYSGEAPLQPVAPVSMANNPSMDVTHLPSSGGYSSPPPSLL
AWKQLTGSIPQMSASMPNLPANSPLATTSLENSKPQVKPGFLQFQEK
Download sequence
Identical sequences H2LKG9
ENSORLP00000006520 ENSORLP00000006520 8090.ENSORLP00000006520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]