SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006548 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006548
Domain Number 1 Region: 583-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-20
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006548   Gene: ENSORLG00000005195   Transcript: ENSORLT00000006549
Sequence length 718
Comment pep:novel chromosome:MEDAKA1:5:9030547:9037115:-1 gene:ENSORLG00000005195 transcript:ENSORLT00000006549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCNSSSADQQQGEMAAVESGGGFSQKRNTNSQKKRPSDFREKDSQQPSPLALLAATCSRI
EPPGENDSSADQHQTQQQQLKINQIFTSNANGWQVVPLSLQTTAGCNTTTTTDSTGVMTG
GEKSRQVLSTSEAAAPSVTGQQVLTTISGMMPNIQYQVIPQFQTVDGQQLHFAAPQQESG
ITGQGQQFQIVSSPNGQQIIAAAANRTGTSGNIITMPSVLPGAIPIQSISLGNGVLQNQP
QILANMPVSLNGNITLLPVSTGATGGDANCAGDGGGHQQVENQTQQPVSSGAGYMTNVST
VTTQTTSYGITQTQKNNGSGTGSFQQSPSSVGVAVQPENRNGQQPQQILIQPQQVIQGGT
SLQTIQAGGQVFAAPTLSQEGLQNLQIMPNTGPILLRTVGPNGQVSWQTIQIQSPTGAQI
ALAPVQSISQLGQAQGNTGAGAVPVNTLQIPGIQTINLNTLGSAGLQMHQIPGVPISIAN
PAVIEGQGGILLVGVVLYLLSFYSGNIFRSLYQDFTSCSLSGDGLEDSMIMDDEDISPPN
QGRRNRREACTCPMCKDGEFVLISDPTKKKQHICHISGCGKIYGKTSHLRAHLRWHTGER
PFVCNWSFCGKRFTRSDELQRHRRTHTGEKRFACTECPKRFMRSDHLSKHIKTHFNKKVG
TVTNSSTLAGDAASPAAGTEAGSGAVSANDQHSIVTMETLSAESLARLASSGINMMQV
Download sequence
Identical sequences H2LKJ7
ENSORLP00000006548 8090.ENSORLP00000006548 ENSORLP00000006548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]