SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006671 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006671
Domain Number 1 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 245-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.3e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006671   Gene: ENSORLG00000005292   Transcript: ENSORLT00000006672
Sequence length 824
Comment pep:novel chromosome:MEDAKA1:19:5922760:5927590:1 gene:ENSORLG00000005292 transcript:ENSORLT00000006672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNGGMDPNFAPGMLMFSHLPPVTSFTRLASQSVMGELPQEMILKKERDSPPDHQGANAAN
TGGFLHSMGIKQERLSELDYRMPLYSGGGGVGVNCAGGGAGKSGTDLPEVSFVNHHQNHQ
NMLLHDLSLSNVRSLEEAMAGRPVKEPKESSGRRGRRGNGDGQGGKVRRKRNDASKQAMM
LDADGACLSPNSKPHICEHCNAAFRSSYHLRRHVLIHTGERPFRCSQCNMSFIQKYLLQR
HEKIHSGEKPFSCDQCNMRFIQKYHMERHKRTHSGEKPYRCDTCQQFFSRTDRLLKHKRT
CGEAIKKGLDPNMLELSEAELGQGSYSVTQGNASSSGRKRGKSKNSEGGERKRKKNASAA
ASSSEGMARELGLHDFNMEHPSGSDSAMQGRTPKLVFKKSARKGLDKGLLSLDDGADEQK
LLDQKSVSMDHVEASGLDSMGLLQGPGANKPGPTTSSNYDDAMQFVKKRRYLHAVNNDYG
AGSLHMASQGNSVIQGSLGPEPTLAMLDSPLDLKHDKSGIPDEVLQSLLDHYSHKPEGTH
HHDVTFDLSDHPHHVDLQPAAPVTPELEDDSGNGSDKSAVMNEYSKFLLQALERTSHSGP
FPSLGPTGPFPLLSSSSSPTGPLFSDKHVYTTSPLDCGYPPAVSSPLPIAASSSASSSSS
SKSHYGMLVGSPSQTGYHLSLDSTSHQQLTPSQELTEQLEKQHSPGTFSIPTQELAATAE
GPKGPQPKNGGSTAPSNGSTYPDLSPLNPPKESTYQIENFAQAFGSQFKSGRRTPLSYGS
DPGAEVDHRIRTPVSEFSGYTSLLADVSEPVSTGSKTPTSQSFR
Download sequence
Identical sequences H2LKW4
ENSORLP00000006671 8090.ENSORLP00000006671 ENSORLP00000006671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]