SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006783 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006783
Domain Number 1 Region: 118-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000114
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 91-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000668
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006783
Domain Number - Region: 185-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0318
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006783   Gene: ENSORLG00000005380   Transcript: ENSORLT00000006784
Sequence length 218
Comment pep:novel chromosome:MEDAKA1:14:12918729:12923229:-1 gene:ENSORLG00000005380 transcript:ENSORLT00000006784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKKKRGACGAWQWKEPDKTIVSEHPTKEASFAMETRLPPTVHPTVGMSAHGAAE
APVPVPFTGPGDDGRQKWSKPRPRPSTVSGDFVCSVCHKVFPLQRMLTRHLKCHSLVKRH
PCRFCGKGFNDTFDLKRHMRTHTGIRPYKCELCEKAFTQRCSLESHMRKIHGVHQQYAYR
QRRSKIFVCEDCGYTSSRPDEYFLHVRQRHPGSPALRR
Download sequence
Identical sequences H2LL73
8090.ENSORLP00000006783 ENSORLP00000006783 ENSORLP00000006783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]