SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006810 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006810
Domain Number 1 Region: 274-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000663
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 307-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000144
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006810   Gene: ENSORLG00000005407   Transcript: ENSORLT00000006811
Sequence length 345
Comment pep:novel chromosome:MEDAKA1:1:16775951:16779657:1 gene:ENSORLG00000005407 transcript:ENSORLT00000006811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMYDYPPATDMDTVNHESFYPSLMNPPEPYRVIFPHPAPLYQMHLPPFAASHNPSNPTQ
NQLEPVDLSVSKRSSSPPHSSSSSSVASSPSSPPSPYSRASPRSPLSQLRCSPSHALPPA
APSVPYHSMVTPVISSSPGVMVSPVMVPILYSPHLHLQPQIIMSPSAVNDEISCNMLSSI
ERNEKEVKENHVKLIKNLNHQCSFKHFKLVKRIVFLSTNSLRSFLRELCNGQSVITIISS
NPQHPLPPDSPDSLKKRRIHRCDFSGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWK
FARSDELTRHYRKHTGVKPFQCPDCERSFSRSDHLALHKKRHLLV
Download sequence
Identical sequences H2LLA0
8090.ENSORLP00000006810 ENSORLP00000006810 ENSORLP00000006810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]