SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006851 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006851
Domain Number 1 Region: 243-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000396
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 2 Region: 168-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000382
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 3 Region: 330-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000411
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006851
Domain Number - Region: 117-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000191
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 280-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00969
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 11-33
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0489
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006851   Gene: ENSORLG00000005444   Transcript: ENSORLT00000006852
Sequence length 495
Comment pep:novel chromosome:MEDAKA1:13:11714414:11717582:1 gene:ENSORLG00000005444 transcript:ENSORLT00000006852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKRLENFEVVCEWASCGFSGHTMEELSDHMSAHLNEYLGDNDALEELDEYACLWNACE
FLAMGSPAELEVHAYSHNYHSKLKFVGSQLLKSRPDLPSCNQGVHSNNLLPEGSDGYVCQ
WEHCDSTFNNPEWFYRHVNNHIESTELQTLSQQQQALFCNWAGCDAFFKIRYRLREHMRS
HTQERLVACPTCGSMFSSNTKLFDHLQRQAEPIESLVCEHCSKAFPSERLLRDHIRQHVN
QVKCPFCDMSCTTLAALKIHIRFRHCDERPFPCDFCDKRFKNQRDLQKHTEVHNEGTVFH
CSVEGCDYSCHTFQTMSHHFKRVHEVGGMSKYKCHICGKVFSWCYTLTLHLRKKHELKWP
SGHSRFRYKKDVDGFLKVNMVRFETVEVTKEIMKNMAKKPQRLRQSQRSSSRNRRAAVAP
ESGRSSPTGDLSGEDVSSQYSPRGGDSPVYCVMSTIDHLEEEEAGLPQEDSEVGGTSGAV
QVLTKVARGLGMDVV
Download sequence
Identical sequences H2LLE0
ENSORLP00000006851 ENSORLP00000006851 8090.ENSORLP00000006851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]