SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006860 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006860
Domain Number 1 Region: 294-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-16
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 
Domain Number 2 Region: 260-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000538
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006860   Gene: ENSORLG00000005451   Transcript: ENSORLT00000006861
Sequence length 437
Comment pep:known chromosome:MEDAKA1:10:13218017:13243770:1 gene:ENSORLG00000005451 transcript:ENSORLT00000006861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNNSSSSGGPGCGQDGAQSASAPEGAGFGSGEPGEPYDHLTGDTLPDIPFNCEKPNVEQT
YPTQRLPPISYTGRFTFEPATSCSNSLWAEPILGLFSGLMTTSSSSSSTPSSSTSSCSTS
SSTQGSSLSSSIHHSEPNPIYSAAPTYSSPNSDIFPDQSQSFPASAGGVQYPPPAYPNGK
TCGSFPVPMIPDYLFPQQQGEISLVPPDQKPFQNQSNQPSLTPLSTIKAFATQTGSQDLK
GVYQSQLIKPSRMRKYPTRPSKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPF
QCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHLRQKDKKAEK
AAAASSYPSPITSYPSPVSSYPSPVASCYSSPVHTSYPSPSVATTYPSASMSNTYQSQVG
SSFPSSVASTIYSSPVP
Download sequence
Identical sequences H2LLE9
ENSORLP00000006860 ENSORLP00000006860 8090.ENSORLP00000006860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]