SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006866 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006866
Domain Number 1 Region: 369-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-18
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 
Domain Number 2 Region: 416-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000236
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 3 Region: 322-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000366
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006866   Gene: ENSORLG00000005455   Transcript: ENSORLT00000006867
Sequence length 1461
Comment pep:novel chromosome:MEDAKA1:5:9342253:9357713:-1 gene:ENSORLG00000005455 transcript:ENSORLT00000006867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVDMQPHQGLYYYETSPNQPSRGKGGIPKNQSPYSDVSSVRAPLLEAPPPDCHSMYNSM
TPNISHGSGQGNGHCMDQYMRPPQAPPPHSMMGHRGMPLTDGGNGAPYCNQNNIVSSHHN
FCQIQPGSDQIGSADGSRFSTPRSMLKLSKKRALSISPLSDASVDLQTVIRTSPNSLVAF
VNSRCNPNGASSYGHLSVSAMSPSLNYGSNINCQSRQQGSLYGGNGGMPLSGHTPGPCQA
SRLPPHNPRLLAPPKHGHLKTEPGLGGVIEGMNVKTMEERSEGDVASPSSTGTQDPLLGL
LDGRDDLDKEDGKPEPEAVYETNCRWESCNKEFDTQDQLVHHINNEHIHGEKKEFVCHWQ
ECSREQRPFKAQYMLVVHMRRHTGEKPHKCTFEGCNKAYSRLENLKTHLRSHTGEKPYVC
EHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHI
TKKHRGDTGPRPHGAAMTAGVPNSELLLEKEETRREDCKLLAPETTLKSQPSPGGQSSCS
SERSPLGSTNNNDSGVEMNINAAGSLEDLTVLEDGVTGGGGEPGTMGMSAQALKRLENLK
IDKLKQIRRPTPPGRCASNKLPAISGSAENMGMCAPSLLLSNRRVMELSNHELGGGMTAC
STNDRRGSGTSSLSSAYTVSRRSSMVSPYLSSRRSSDVSQIGGTAGGGCHLLSPEEAGSD
PLSPETSRRGAPCSVGAGLPSLPNLTPAQQYNLKAKYAAATGGPPPTPLPNMEQPATPGR
RGGVLSEYHGQPLPPFLQQVGPRRHSANTEYGTGIIYPHQAPGNNTRRASDPVRSAADPQ
ALPKRFNSLSNVAMMGRRNAMQHRGSDTSLARHLYSPRPPSITENVMMEAMGIDPHLTPL
DSRERSMMISPGERNFMGYQQQNQTIGSGGPISNQLSPSRDSLSCPVAGNMQRHFQGQGG
DVSSRAGVNPTGQGRPSQPEGMSNALLQQAEYGMSTCQLSPSGPPYPNIGHVGDTGGHWN
DAPNQNQQTMSYSDPSVHPQQAQVHFNNQPAIYNSSHGAQKLNIKPEQQFHPGMGVGDAC
QNAKLHQQRMLLQQTQGYPQQTGPAMARGSSNPTCDFQGPNQNSFPGGGGLNLRCAGSAL
ADGQRSETPMMQVKEMMVRNYVQSQQALMWEQQAQQHSGIKPTACSDNVGLDVQPAMVQQ
SPQQQDQNFFPSQTYHSYSNQNLVMSPASHRGPSSATPKDQQLTGLQGSCYNQEMVVPRP
PQGRKPMSRQNSLSQAGGVFLDSPPHLSPVHSTTSPRRGVRLPPVQHPQHPQNEMFSPSN
NNNNNMFYSNQMNMDLEKHMDPQNGPCLNQQHNVGSNLEPTGDAKSLSMTSYPLTSPTSN
ALENLDLDNARIDFTSIIDDAESSSFSPINNHLQGQPGSSSQASSRLTTPQTSSLSNMAV
GDMTSMLTSLAGENKYLNTLS
Download sequence
Identical sequences H2LLF5
8090.ENSORLP00000006866 ENSORLP00000006866 ENSORLP00000006866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]