SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006913 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006913
Domain Number 1 Region: 321-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-17
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006913   Gene: ENSORLG00000005490   Transcript: ENSORLT00000006914
Sequence length 395
Comment pep:novel chromosome:MEDAKA1:15:18001214:18007731:1 gene:ENSORLG00000005490 transcript:ENSORLT00000006914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRYLSPQPPPFPAHGDTQQKLNRDGTPSVDQFFADDPSGAPYTLNMNLYLPDIAYLRMG
VSQQVRTPHQNHAGLAQIKTEAAPSCFSPNLQPLCPNAAPTSGLPDFTSVFTQSRGNRGA
DSVPEVFVKQEMPSQFEQHGLHHDNSSPLFQLLNSGLDHQNNAMEVHHHHHQQQQIQHNS
TTPVHTPFHDLPVASSTSQQEQAVKPAYHSMANGVYSQSHTQVHPHFLQQQVPYLPPSPP
SSEPGSPDRQKELLHTMSPPPSYAATIASKLAGSPPGLAPGTGPGNQSPIQNPVRYNRRN
NPDLEKRRIHHCDYPGCKKVYTKSSHLKAHLRTHTAGEKPYRCTWDSCDWRFARSDELTR
HYRKHTGAKPFQCAVCSRSFSRSDHLALHMKRHQN
Download sequence
Identical sequences H2LLJ9
8090.ENSORLP00000006913 ENSORLP00000006913 ENSORLP00000006913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]