SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006915 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006915
Domain Number 1 Region: 689-954
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-75
Family Protein kinases, catalytic subunit 0.0000041
Further Details:      
 
Domain Number 2 Region: 1693-1977
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-60
Family Protein kinases, catalytic subunit 0.0000426
Further Details:      
 
Domain Number 3 Region: 189-308
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-29
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 
Domain Number 4 Region: 312-411
Classification Level Classification E-value
Superfamily Immunoglobulin 7.94e-23
Family I set domains 0.0095
Further Details:      
 
Domain Number 5 Region: 583-677
Classification Level Classification E-value
Superfamily Immunoglobulin 4.75e-22
Family I set domains 0.0089
Further Details:      
 
Domain Number 6 Region: 2-177
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-21
Family DBL homology domain (DH-domain) 0.00082
Further Details:      
 
Domain Number 7 Region: 402-496
Classification Level Classification E-value
Superfamily Immunoglobulin 2.5e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 8 Region: 1583-1683
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000746
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006915   Gene: ENSORLG00000005492   Transcript: ENSORLT00000006916
Sequence length 2009
Comment pep:novel chromosome:MEDAKA1:4:9190656:9209548:-1 gene:ENSORLG00000005492 transcript:ENSORLT00000006916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLIQGLIDGEDEFVRAMRTFISNQLILLESRHQVPVNVLSQKEIIFRNVKDIVLLHESSI
LPALRGCATDDDVAALLIKHREDFEKYLLYMGGQAQAEACISDKAVQQCFKELIGPEKLG
SSVMGVLTFLQQPGERIQTYQALLKELIKNKAKSGQSCYLLEDAFSLVSCLPWRSNNLHQ
VSLIENYPAPLTALGEPVRQGVFTVREESPEIKAAARGHQRQVFLFKECVVLCKLKKDSN
MSKDTYAFKNKMKLNDVEIRESVGGDERSWGLWHEHRGSIRRYILQAPSSLVKLSWLKDL
KELQQRCSLHTNCSPVFESQLLDFVAKIGQTIKLTCRVSGSPKPLISWIKDGLPLEDDPR
HIITTDRSGRCNLILDSLSPEDSGQYLCYATSCMGSAGTLAKVVVQAPPRFVSRLESACL
IEGEDTQFCCSTFPIPLPRVRWLKDGKELTDQQKYTIVSDARSGILSLTVVGATEADIGQ
YECELWNELGCVKCKAGLCPAFVPPTDSEKDQPHDLPAKDADSEGWSAAFVKKWLQTDFS
PASIAKKIFPLGYSEQSDFRRQELEEEEEEIYISEQMQEITDAPPSIQVPTEDLCVQPGQ
PATFTAIVTGRPAPKIQWFKQDGGVLMANENVKIVQHGARCSLTVVCSEGEDSGIYTCYA
HNDSGQASCEAQLTVEEVGPLESQEREVELGKRRKLFSVYDVHEEIGRGTFGVVKRVIHR
RTGEVFAAKFLPLRSSTRTRAFQERDLLSRLAHPRIACLLDFFCTRRTLVLISEMCCSHG
LLDHLLLQSSVSEKEIQSYIQQILEGVGHIHSMNILHLDIKPDNILMVYPPRDEIKICDF
GFCQEIDASRHQYSMFGTPEFVAPEIVHQEPVTVASDIWAVGVVTYLCLVGRCPFVGDTD
RATLLMVGEGTLNWDTPDVNGRSSEAKKFLRMLLQPDPEKRPSAMDCLSHEWFQDESAGE
DTDKINTRSLKVFISKRKWQRSLTCIGSVLTLRPLPELLDAPLRETSVTVPRDPQAHSST
SLSSGSSSEYDEADSWDFFQHCSQTEEEVETDEEFDPMAERAQIPEEEDEEMLERRSGME
RSISRQSFASSTTTDQGTPQRERRFSKDSNPSLYLSEGDEGSGSDGGRIPRGSLICSTFY
NTSQQLSPMSARHMTLRDKFQAKKQERGRKPLRRSFSGRLNEPLIEYVEDETETGRAQRR
GSVQPAMQKSCSFDSGVSLAHVNLPPHRRSRSLDEYSRRSPSSPIHVRRSDEEGTQSMKE
DFTDSDAAGRSLPSVVHSQRASRRRGSVTPGQRSQTLSGSSPASDVIAGGRMGSRLEQAQ
TEEEAFTGSQGSLAESFILAHGGSESSSRLGSFEKLSHGHLRENYRSGESDGYDEQAELL
LPPPPSSFHRVTPRNSVPKAPPRNRTRSNPNLSNSRGQSGTPSPSPSLCSLQTPDRPPRA
RDRKDGLQRHASAPALEAPPPSGKSPKLGILKFFRRQSWTGHSYSQLDNTELGPTLGEIM
KPDTPTMSLRKKMKASASSLTKLFSKSSSKEDLSKGGPIVKGSDLIPPERDSRSSLDKKS
SKMFASFKIPSFKKAQVSQRLHEPVRPNKPEVLQLHRGGVLLVWRPVRSSDPVSYCVQYC
TDGGEWTILADQVTDSCYAVKDLPRGASYVFRVGCITKTASGPFSEASSPVVMATHPEEV
LIPLVQIESLESKVTVGEGQTSKKSYSFLSEINRGRFSVLTLCRDAETSHVFAAKITSYQ
SEQRQLVLREYQLLRRLHHSHLVQLQDALIAPSHVVLVEELCPGKELLHSLAARDLYAET
HVTELLVQILSAVDYLHSRRVVHLDLKSDNMLVDDCNHLKIVDFGSAQCFVPGQPLHIEH
IHGISDSKVYIVLPKAPEILEGQGVGPETDVWAIGVLSFIMLSADSPFEADHSWEQDKHI
KKGKIQFGCCYPGLSEGALTFMKSSLNNKPWGRPTAAECLQNPWLRAHRATHRARYSKVC
FSTDKLKAYLEQKEEKRDQVRTKIHIPLR
Download sequence
Identical sequences H2LLK1
8090.ENSORLP00000006915 ENSORLP00000006915 ENSORLP00000006915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]