SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007006 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007006
Domain Number 1 Region: 124-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000575
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 389-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000248
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 3 Region: 96-133
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000255
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007006   Gene: ENSORLG00000005569   Transcript: ENSORLT00000007007
Sequence length 442
Comment pep:novel chromosome:MEDAKA1:15:18082212:18085625:-1 gene:ENSORLG00000005569 transcript:ENSORLT00000007007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEEKPDTLDFVKDFQEYLSQQTQHVNMISGSVSGVKEADELPAATQKQADLATPNTPCP
DCSQNGLDHPSVDISLEDNSGILVDGFERTYDGKLKCRYCNYATRGTARLIEHIRIHTGQ
TGEKPHRCHLCPFASAYERHLEAHMRSHTGEKPYKCELCSFRCSDRSNLSHHRRRRHKLL
PMKGARSLSHKKMLSVLQKKASSLGYGRRLLVNFSPPSMVVHKADNVNDFSHELPHLHQE
TYDDQNRVVEDELSANQGHHPRDMVMDNPLNQLSTLAGQLASLPSDSHAQTQPPISPGAD
SVVDEKPFLIQQPHPATTPVAVTASMTHASSSSPITPEPRAPPQSNCSPGGGPCSEHSGR
TSTPSISNSQPSTPAPGLPTPLHDPHMLHHCQHCDIYFPDNILYTIHMGCHGYENPFQCN
ICGHKCKSKYDFACHFARGQHK
Download sequence
Identical sequences H2LLU1
ENSORLP00000007006 ENSORLP00000007006 8090.ENSORLP00000007006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]