SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007007 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007007
Domain Number 1 Region: 1727-1790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.94e-27
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 
Domain Number 2 Region: 2148-2197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000676
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007007
Domain Number - Region: 2035-2083
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000136
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 1902-1929
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000196
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number - Region: 2249-2284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000874
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 1856-1910
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0014
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number - Region: 102-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00155
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number - Region: 197-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00159
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number - Region: 382-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00353
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 486-510,698-722
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.025
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 1420-1451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.055
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 1931-1960
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0701
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number - Region: 1512-1537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0745
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 1320-1346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0881
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007007   Gene: ENSORLG00000005567   Transcript: ENSORLT00000007008
Sequence length 2288
Comment pep:novel chromosome:MEDAKA1:12:8438288:8454557:1 gene:ENSORLG00000005567 transcript:ENSORLT00000007008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALQCDGCDFRADSYDDLKNHIQEVHTAFLQPADADESDSVRDENGDEEEVEEYADKDD
KDYTPAKAGMSMCATLISLGPSSTQSPSQASARSTAESHPSFFQCKFCVRYFRSKGFLRN
HTRKVHNVVEQDSDTSAKQPRDTVKVPNSKGYFCEHCTYKSKYQARVLKHQLMCHKAPSN
TAGDDAGGAVAEEKLDSENVKGTFPCEWCDYQTDQKDSWTDHVAKEHSDKVNVVSSGAKL
EEEAGAPSPKPDTPSSAESPTTSKVSCAGKEDSTGPTPEKMLENATADIANIQYTHISAA
TPNSTGSSILSKRFVSTNCVINTNLANDEDSRSSLEDDDEELDMDDPSYTGTLSADAKQL
LTDDDNKLLETKGIPFRKYMNRFQCPFCSFLTMHRRSISRHIENIHLSGKATVYKCDECP
FICTSPLKLGTHKQTHSPSDLETLDLTGDSPEPPNDGATESVNGGSISTRVNGKKATSTP
NDQQNPHRCTLCSFSTTTLKGLRVHQQHKHSYCDDLDSSVFESQITDNTDSEVEASPIFV
QKTQTPILGLATKKPLVSGKRARKSINDLPLDLSSVKKRTRIDEIASNLQSKISQSQQDM
IINLDDMEDEDAGENSASADEGRNYDNNKIFAYNTHQLLAVEGASSHEGVRIGKRKSNPK
SKPRSIPISLMLSDDGENMSVDPSDHALQDTMDYSDEPGTTRFYCKHCDYHNKSARSVST
HYQRMHPYIKFSFKYILDPEDQSAVFRCLECYIEYTNYNDLHQHYMDHHPEASNVLNFNQ
PHLLYMCRFCSYTSPNVRSLMPHYQRMHPTVKINNAMIFSSYIVEQTHKSGESQTLREIL
NSGPKNFNSSSPGPRSSSSPVLKSVPRSPEASSEAESLKESASGNVVLYDCDVCSFASPN
MHSVLVHYQKKHPEQKASYFRIQKTMKVISVDQSQPVANSSFSPSMSTTAKRQSAALYGS
DEDMYYCKHCVYSNRSVVGVLVHYQKRHPEVKVTAKYIKHGPPTPALIKLMDDLQIAAPK
QFLKQLQNNGYDGSSNSSPKPGGSDKGKDELFFCQHCDYGNRTVKGVLIHYQKKHRETKA
NADLVRRHTAVVRSQRERAQMVQAGSASSAATSAPSDPENAAPLRSLKCRHCSFTSPYVY
ALKKHLKKEHPTVKATAMTILHWAYQDGILEAGYHCEWCIYSHSEPQGLLLHYQKRHPEH
NVDYAYMASKLWAGPETTQQGGSMEGKHYKCKDCAFEACSIWDITSHYQAVHPWAIKEDE
SVLLDIIKGNGSDENIHQQVAKEHESLNCQVIDDDGALVIDTSPQESTAHPSHPRLSISN
NPYQCTVCLSEYNSLHGLLTHYGKKHPGMKVKAADFAQEADINPSSVYKCRHCPYVNSRI
HGVLTHYQKRHPLVKVTAEDFADDIEQITELHDGDDKFKTQRQGYGAYRCKMCPYTHGTL
EKLKIHYEKYHNQSASDMFTASMTHFTQCKDTEPVAECSVGNTSTVQVQEVSELDFALSQ
LPINKTEKHAVFKCQLCKYFCSTRKGIARHYRIKHNNVRAQPEGKNNVFKCALCSYTNPI
RKGLAAHYQKRHDIDAYYTHCLAASKTISEKPCKVLAPMSSEGASSEMSEDLRLAIESRR
CNLCGFQAFSRKSIVSHYIKRHPGVFPKKQHASKLGRYFTVIYAKEPDKDDSASAEEDKE
ILEVPFEPEQETDNDWLPFKCLKCFKLSFRTGQLLSMHYNDHHNADLRRDFLVSSDPEDE
NEDLYQCSHCELKFLALPDLAKHLLNHNEEFQKRAMRQERRRQLISKQKTELLDHKLDKV
SMKSLQESPLGKTPVGYRCNFCIEIHPTLRAICNHLRKHVQYGEVKEGQIKVWKGLRSHE
RSHSAMALFSREDKYSCQYCQFVSPFRHNLDRHMQTHHGHHKPFKCKFCPFKSAYASRLK
SHLLKAHTGEQHTYKCLSCPFSTMTISQLKEHSLRDHGEALTLHKLRAASQAAHAALRTS
RMIASMEQTPMLSDDSTYQEPADVCQQLNHYKLASRSQMSSCSKLGGLAAPDGVLTCEFC
EFSSGYMQSLRRHYRDRHGGKKLFKCKDCSFFTCNNNTFIVHVEAGHNNNNNNAPQELPD
DLRCPLCLYHTKHKSNMIDHIVLHREERVAPLEFSRSKLSRHLRGLVFRCHKCTFTCSSD
QALQLHLQKHEEIRPYKCQLCYYDSSRQSQVEEHLRTEHKVIRNFELMVRVNLDMLEMLK
EHGNSTEDEEDELDLMGMAMGGQDPKSTSQKGKSLHSKEKRLPCEFCGRCFTNSQEWERH
VLRHGMSV
Download sequence
Identical sequences H2LLU2
8090.ENSORLP00000007007 ENSORLP00000007007 ENSORLP00000007007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]