SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007063 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007063
Domain Number 1 Region: 223-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000184
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 256-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000761
Family Classic zinc finger, C2H2 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007063   Gene: ENSORLG00000005620   Transcript: ENSORLT00000007064
Sequence length 292
Comment pep:novel chromosome:MEDAKA1:17:6895724:6900334:1 gene:ENSORLG00000005620 transcript:ENSORLT00000007064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMDVIPMCSIFQELQIVHDTGYFSALPSLEEYWQQTCLELERYLQSEPYVSASDLKFENQ
EDLWSKLMLACGDNSTKSDPKIPHIKEEEDNQDQHLDAGGFNSDASSEASDSSEELSPTL
DFAPGSLTDILAXXXXTDILADSGEDLGSAIISTPPSSPELGKEGSGVTQVWSGIQTVLH
SPGKIRTGVVERSGLTSGEASPDGKRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYR
CSWEGCDWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHI
Download sequence
Identical sequences H2LLZ4
ENSORLP00000007063 8090.ENSORLP00000007063 ENSORLP00000007063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]