SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007096 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007096
Domain Number 1 Region: 363-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000282
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 396-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000229
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007096   Gene: ENSORLG00000005643   Transcript: ENSORLT00000007097
Sequence length 432
Comment pep:novel chromosome:MEDAKA1:12:8469495:8471940:-1 gene:ENSORLG00000005643 transcript:ENSORLT00000007097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGGTLLPSISTFASGPVDKSRTIGSAYIKWKEELFHVKRSSVPAGSSCSDLDLPTATS
MSKKDPEPDLDLDYDFILSNSIQEDGGGLACGSARVLSPSPGSFSSSFQLPSPQDAASEL
LYTIPDISDVSPSGGFVAELMRPELDPAYLHPTGVHGKFVVKATMEAGEYGKACANAGSD
SRVSPSFPCHRIKQENPSNCTISQTVDLHLSRGGQQRPGHLDLHGFPSGGRSVTASRLSS
TSSLSPDLPLGREHQLGHPLTQMPLPPQGYHHGSPQGYPSYPQTSAMQYPGLLPTVYKSA
GILQTCFDGSHVCSSFAEALMISSGDCLPEEPKPKRGRRSWPRKRVATHTCDYVGCGKTY
TKSSHLKAHHRTHTGEKPYHCDWEGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSR
SDHLALHMKRHL
Download sequence
Identical sequences H2LM26
ENSORLP00000007096 ENSORLP00000007096 8090.ENSORLP00000007096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]