SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007261 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007261
Domain Number 1 Region: 12-134
Classification Level Classification E-value
Superfamily POZ domain 4.32e-30
Family BTB/POZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 394-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 430-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000852
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007261   Gene: ENSORLG00000005778   Transcript: ENSORLT00000007262
Sequence length 506
Comment pep:novel chromosome:MEDAKA1:12:8794314:8796287:-1 gene:ENSORLG00000005778 transcript:ENSORLT00000007262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHHREEDLIGIPFPNHSSDVLCSLNEQRRDGLLCDVILIVRDQEYRTHRSVLAACSQYF
KKLFTVATTDGGDAHHAAAVYEIDFVAPESLTAILEFAYTSTLTVTASNVKEILNAAQML
EIPCIINVCLEIMDSGGSRKDEQEKEEDNASERSLESKGEPMHLGAEDSPPPSTSTLHQR
REPSQAQSPGGMRGKQVQESMESRALKDFSIDSLLQEGLYPRMATVDRKPTFSPLIPGFY
PSLWAEFPAFPQQLLNPTHPHAGVSPQVRLPPPFPPSAPIEPSRPLDLAVKREIIKEEMK
EEVPPSLLHSDFLKEFVSSGLGSTISPGPAPSEGHPLGPIKSEADFRSYLSLLNSASHLG
ALFPPWQLEEERKMKPKASQQCPICNKVIQGAGKLPRHMRTHTGEKPYMCTICEVRFTRQ
DKLKIHMRKHTGERPYICLHCNSKFVHNYDLKNHLRIHTGVRPYQCEHCYKSFTRSDHLH
RHIKRQSCRISRPRRGRKPAAWRSAP
Download sequence
Identical sequences H2LMI9
8090.ENSORLP00000007261 ENSORLP00000007261 ENSORLP00000007261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]