SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007296 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007296
Domain Number 1 Region: 464-743
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.55e-43
Family Eukaryotic proteases 0.00000523
Further Details:      
 
Domain Number 2 Region: 190-457
Classification Level Classification E-value
Superfamily vWA-like 1.56e-29
Family Integrin A (or I) domain 0.00014
Further Details:      
 
Domain Number 3 Region: 87-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.00035
Further Details:      
 
Domain Number 4 Region: 152-207
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000032
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 5 Region: 33-94
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000032
Family Complement control module/SCR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007296   Gene: ENSORLG00000005801   Transcript: ENSORLT00000007297
Sequence length 764
Comment pep:known chromosome:MEDAKA1:14:13321470:13381784:1 gene:ENSORLG00000005801 transcript:ENSORLT00000007297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTSVIWSLLVFLLLCTGEVECQCTADGLEIQGGTYTLTKGLETNSLLVYQCPDNFYPYP
DTIRVCHPNKQWKPRPKKFSPQRCKPVECPDPNVLENGNVFPPLERYLAGNTTTFECYSG
YTMRGSSSRTCLSNGKWSGSTTICSRDSGDACPDPGVPPGASRRGNTFDVGYDVTYSCNG
NLFLVGSRVRVCQENSQWTGREPACYSKFTYDTSQEVSEAFGSSIKDSLTTLQPTNDTQA
GRKIRISKNGTLNIYIALDISESVEEEHFKRAKLAIITLIKKIAAFTVSPNYEILFFSAD
VYEVVSIVEFYEGKITLESAIKNLEDFQIGGKDKSTGTDVNAALKKFEEGMAWIEQKTGD
KFSEHRHVFLLFTDGAYNMGGSPLPTLARIKNRVYMSPTGDPGSRLDYLESYVFGIGANI
FDDDLLPLTAGTEGELHYFRLKKETNLAATFDDIIDENEVIGLCGLHRDYELTADKDGKR
RRYPWVVFINIQGKSPKKCLGSLVSSEFVLTAAHCFIFSDEPQDVKVEIDDGKGSKEKKV
KTFKLHPQYNVTARVKQGVAEFYDYDIALIQLERPVQLSISARPICIPCTKETSDALRLP
GSATCRDQEELLLKNQRERLSFLTRTEPLVGEKDVYAKLGDNRDLCIKKALKAKGITTTD
PKVPVTDNFLCTGGDRDHIACTGDSGGAVFKNYESRTIQIALVSWGTQEICTGGGMRETT
PESRDFHINLFKMVPFLKSILGDDDQDDYAPLTFIKDNRTIKTH
Download sequence
Identical sequences H2LMM4
8090.ENSORLP00000007296 ENSORLP00000007296 ENSORLP00000007296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]