SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007366 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007366
Domain Number 1 Region: 171-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000683
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number 2 Region: 116-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000194
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 147-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000482
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007366
Domain Number - Region: 215-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000708
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007366   Gene: ENSORLG00000005855   Transcript: ENSORLT00000007367
Sequence length 277
Comment pep:novel chromosome:MEDAKA1:1:17396838:17401767:1 gene:ENSORLG00000005855 transcript:ENSORLT00000007367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEEEGLSSDEDPPFRDDLNDQSYDPRDERDAAKPKRRAPPRNKEKKDKDKGPKKEEEVDE
IKVESSESVEIVQEEVKMEEEVTEDPDGPRKRGRRKKDDKTPRLPKRRKKPPVQYVRCEM
EGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCGRLFRLQKQLLRHAKHHTDQRDYICE
FCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADATYQFSCSIC
GKKFEKKDCVVAHKAKSHPEVLIAEALAANAGALITT
Download sequence
Identical sequences H2LMU3
8090.ENSORLP00000007366 ENSORLP00000007366 ENSORLP00000007366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]