SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007383 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007383
Domain Number 1 Region: 201-418
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-59
Family DBL homology domain (DH-domain) 0.0000507
Further Details:      
 
Domain Number 2 Region: 409-543
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000889
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 3 Region: 558-617
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000197
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007383   Gene: ENSORLG00000005869   Transcript: ENSORLT00000007384
Sequence length 639
Comment pep:novel chromosome:MEDAKA1:13:12198467:12223244:-1 gene:ENSORLG00000005869 transcript:ENSORLT00000007384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVVLSTYSPAALKMGTQQLIPKGLASDIRHSKSSGTQSQGLAGLLSVDHSKRSVKALSMV
ETGAYFSTGHTERGDDENEGPGTLKRGLRSTSYRKAVVSSMDMEESLLMKPFQMLTLESP
ELKQSPTSPDPSGADSSPARKAVLVSQPTFDSEEELYQNYKEKALHNDSDEDADAREIKP
DDCIVVQYRPLRTTWSQLTVVKKSGLSEKLSQEERKRQEAIFELISSEHSYFHSLEILIR
LFKDSAELRETMSKMQHHHLFSNISDVCEASKEFFKELEERHEKNIVISDISDIVCKHAQ
SNFDPFITYCSNEVYQQRTLQKLLSTNPTFKEVLTKIEAHPDCRNLPMISFLILPMQRIT
RLPLLMDTICQKTPKTSRQYEDCKTALQEISKVVRKCNEGARTMERTEMLCTINSQLEFK
IKPFPLISSSRWMVKRGEVTSLVEGVFLKRTTRQHLYLLLFNDVLIITRKKSEDSYTVVD
YALRDEISVSLYQPDDLKTMLSPRPSSNHLFHLHFEHNHSGEKMHRILGTESLNERARWI
SALGQNPNNKDQDRSSNSDAIQVEVIRTYTARQPDELSLQVADVVLVSQTVDGWYEGERL
RDGERGWFLAECAVQITCQVTIERNMQRMNRLQGLETDV
Download sequence
Identical sequences H2LMW0
ENSORLP00000007383 8090.ENSORLP00000007383 ENSORLP00000007383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]