SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007432 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007432
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.7e-28
Family Chaperone J-domain 0.00026
Further Details:      
 
Domain Number 2 Region: 307-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000675
Family Classic zinc finger, C2H2 0.088
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007432
Domain Number - Region: 511-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00189
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007432   Gene: ENSORLG00000005913   Transcript: ENSORLT00000007433
Sequence length 561
Comment pep:novel chromosome:MEDAKA1:12:9113679:9122475:1 gene:ENSORLG00000005913 transcript:ENSORLT00000007433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCHYDILGVKRDAGDDDLKKAYRKLALKWHPDKNLDNAEEAAEQFKLIQAAYDVLSDPQ
ERAWYDNHRDALLKGGLSGDYEDDSIDLLQYFTVTCYSGYGDDEKGFYTVYRNLFESIVK
KELEHRRMENEEEEEEFPSFGDSQSDYDTVVHEFYAHWQSFCTRKNFAWKEEYDTRQATN
RWEKRAMEKENKKTRDKARKERNDLVRQLAAFVRKRDRRVQAHRKLLEEQNAEKIKKVEE
LRRQQKLKQAKLAEEYKEQSWAAMSELEKELQQIEAEYGEEFGDVSESEEDEVDMQENIG
DGGGRGNDLLLDDYDDLYCPACDKSFKSDKAMKNHEKSKKHREIVVLLRQQLEEEEDSLA
LNGDGSKDAGNENELEEGEEEKQRQRLSKKQKRKKKQQKVAENSFFCFPHRKTLWRRRTE
RRRRRRRKRNLPPARKMPLRNGLTLQSQRHRITSLPPSKSVYLELADTFLSINGKHFLPS
SSGKTKGKKGGGKEKTRNAKSQNADEVSEVVNLRCVTCNYEFATRNKLFDHLKSSGHATA
LSSNVLQSSASKSKKDKKKNR
Download sequence
Identical sequences H2LN09
ENSORLP00000007432 8090.ENSORLP00000007432 ENSORLP00000007432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]