SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007617 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007617
Domain Number 1 Region: 145-404
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.09e-81
Family Eukaryotic proteases 0.00000176
Further Details:      
 
Domain Number 2 Region: 52-155
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000144
Family Hepsin, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007617   Gene: ENSORLG00000006062   Transcript: ENSORLT00000007618
Sequence length 415
Comment pep:novel chromosome:MEDAKA1:16:11483148:11488113:-1 gene:ENSORLG00000006062 transcript:ENSORLT00000007618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVGSRGISLTCVLTPWRLIGVCVTVMILGAIGAAVWAVVTYCTTEEETGLYDVQVNSSD
QRLRVFDSAQRRWRQVCSSSANELLASISCEEVGFVSVVNYSVAAVPEGSGDVGDFFCVR
QEELSFGKKIKDSLYPCDCESREVLTLLCQDCGRRSFAADRIVGGVDARQGSWPWQVSLQ
YDGVHQCGGSIISNHWIISAAHCFPERYRFVNRWRVLLGSIYNKPVNANVAEVKTIVYHS
SYLPFVDANIDDNSRDIAVLALAQPLTFSENIQPVCLPTYGQRLIDGQVGTVTGWGNVGY
YGALADVLQEANVPIISDVVCNGPDYYDNQITTSMFCAGYEKGGIDACQGDSGGPFVATD
CLSKTSRYRLLGVVSWGTGCAMAKKPGVYTRVSRFLPWISTAMRTHTFQFSLTQI
Download sequence
Identical sequences H2LNJ0
ENSORLP00000007617 ENSORLP00000007617 8090.ENSORLP00000007617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]