SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007783 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007783
Domain Number 1 Region: 218-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.14e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 179-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000166
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 3 Region: 98-133
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000112
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007783
Domain Number - Region: 276-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00119
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007783   Gene: ENSORLG00000006188   Transcript: ENSORLT00000007784
Sequence length 328
Comment pep:novel chromosome:MEDAKA1:19:6611707:6616609:-1 gene:ENSORLG00000006188 transcript:ENSORLT00000007784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAWSNFLFQSTPTQNQVEGSLQSELMQVHTSSPQTPPTEHIAQPPSTVDTTALSEEPL
PVLKKASHLYSFIYITKSLSSSLAPSVPVKPVSRTARAQHICAICNKQFKNNYNLRRHQS
VHTGAPPPRALPCMFSVTRTVCEQESIHVTSALQNTCRSMSLLILPQRPANPNPNPVKKN
HACETCGKAFRDVYHLNRHRLSHSDEKPFSCPICQQRFKRKDRMSHHVRSHQGGVEKPYI
CPHCGKAFSRPDHLNSHVRQVHSSERPFKCPTCESSFATKDRLRAHMIRHEEKVPCHICG
KLLSAAYITDHMRVHNQSQHHVCHLCNR
Download sequence
Identical sequences H2LP03
ENSORLP00000007783 ENSORLP00000007783 8090.ENSORLP00000007783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]