SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007795 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000007795
Domain Number - Region: 242-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0013
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 267-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.031
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007795   Gene: ENSORLG00000006199   Transcript: ENSORLT00000007796
Sequence length 573
Comment pep:novel chromosome:MEDAKA1:2:30159826:30162534:1 gene:ENSORLG00000006199 transcript:ENSORLT00000007796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CIFCEKDFHGCRVVAHAMFHYRRDECMFCGTVFTDDLLAMIHLSDHIEKLKRLKAPAAPD
DDAKDSPAEAKPSNASLASGKRGRPRKSSTPQKLTDSGPSEPRTLRSDHKQSQKPQTPHR
VNGHMSKKFSRSRRSVDTKEEPVQQEISLEQPGSEEGSSTSMRAARKSACFKKEKKTVDP
LERARCAVVGCSWSADISKNRVAPLYHALEEHYGDTTALQLAFRVANGKCGICSRVMFSF
EHFLHHVGRHRDSPRHPCLHQGCGARFKSGMEMRRHARRHSPLQAVCCLPGCSQLFICLW
ALNLHEKEHFSARPGDSSGDPAASEEPAVKINVDAPPSPTPRTTAAEKQPEGIAPTTEKK
SGLKESSEVQKEQEKTSAPQKMKLKRRHQADSTEAAVVQKGGVGESRTPPSADALPSADA
LPSADALPSADALPSADALPSADALPTAEALPTAEALPCAVQTLPHIQQKKKKKSATREK
QTETKLNKKPYLRVPPTAYLDEKYTAMPKRRKTSFPPPPDNAASPEQTAAAPPQRQRCAK
CFATFTCSEELRGHLQRQNCSKLFGFDSDEEEG
Download sequence
Identical sequences H2LP15
ENSORLP00000007795 ENSORLP00000007795 8090.ENSORLP00000007795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]