SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007961 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007961
Domain Number 1 Region: 44-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000169
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007961   Gene: ENSORLG00000006337   Transcript: ENSORLT00000007962
Sequence length 270
Comment pep:novel chromosome:MEDAKA1:17:9103021:9108285:1 gene:ENSORLG00000006337 transcript:ENSORLT00000007962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEWEDMEEEEEDMDEDEEEAADQKEGDSVDPSGSAPLPGSLPVTDCLFCPHHSKSLLKNV
AHMTKVHGFFLPDVEFLVDLRGLIRYLGEKVGAGNVCLWCNEKGRSFYSTEAVQSHMTDK
SHCKLFTDGDAALEFADFYDFRSSYPDRKEGEEEEEAEEELPDDGNLEYDEDTLELTLPS
GAKVGHRSLVRYYKQRFGTQRALVLTHNTKAVGRVLRQYKALGWGGDAGSALQRQRDMQF
VQRMKSRWMLKMGMSNNANLQKHFRAQVMF
Download sequence
Identical sequences H2LPI1
8090.ENSORLP00000007964 ENSORLP00000007964 ENSORLP00000007961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]