SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007999 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007999
Domain Number 1 Region: 506-569
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000314
Family F-box domain 0.0039
Further Details:      
 
Domain Number 2 Region: 553-774
Classification Level Classification E-value
Superfamily RNI-like 0.0000000129
Family Cyclin A/CDK2-associated p19, Skp2 0.035
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007999
Domain Number - Region: 7-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0903
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007999   Gene: ENSORLG00000006366   Transcript: ENSORLT00000008000
Sequence length 824
Comment pep:novel chromosome:MEDAKA1:1:19445723:19479149:-1 gene:ENSORLG00000006366 transcript:ENSORLT00000008000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLDLPYRCPRCGEHKRFRSLSSLRAHLEYNHTYETLYVLSKSNSVCDAAALLPLVAEG
ALLSPANNNDPFEPLRPSALKERRFPCRELPCVDDLSLTPANSNSAARYIPNVEFPLGEI
FSTKAMTSTDPGPHGNPSTAVAVAANVAASAVEAAYEEGLARLKARAFERLELDERLEKL
SEEVEQKIASRVGRLQAELEKKSCELERAKQESDRLSQEKQELEDKASELSRQVDVSVEM
LANLKQDLVNKEAELNQKQQEVAQIDQFLQETAAREANAKVRLQQFIEELLDRADRAEKQ
LQIISSCGTTPNGSLGRCSLQASKGSGRQRNSSLSGSTRGMYQVSERRSSPSTGASGRIK
SVSQGSGGYDSDSVEMHPMEECPEVQYYQMQCRLGEGGYERSPGCGSRNWGLRKQAIQNW
QRRPYRNSTEGDEGDISDVGSRTTESEVEMSSSLPHPIPTTAGPHIALTQKGRSEGVYSK
SCRHEKSPSKSNEVISPEILKIRAALFCIFTYLDTKTLLRAAEVCRNWRFVARHPAVWTR
VLLENARISSKFLCTLSQWCTQTHSLILQNLKPRQRGKKESKDDYLKSTRGCLEEGLEAL
LKATGSNLLILKISHCPNLLTDRSLWLASCFCRALQAVTYRSATDPVGQEVIWALGAGCR
DIISLQVAPLHPCQQPARFSNRCLQTIGRCWPHLRALGVGGAGCGIQGLASLARNCMRLQ
VLELDHVSEINQEVAAEVCREGLKGLEMLVLSSTPVTPKALLHFNSVCRNLKSIVVQIGI
EDYFEDPNSPEARKLFDEMVNKLQALKKRPGFSKILHVKADSLC
Download sequence
Identical sequences H2LPL5
ENSORLP00000007999 ENSORLP00000007999 8090.ENSORLP00000007999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]