SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008248 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000008248
Domain Number - Region: 427-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00319
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008248   Gene: ENSORLG00000006570   Transcript: ENSORLT00000008249
Sequence length 561
Comment pep:novel chromosome:MEDAKA1:15:20165349:20167612:-1 gene:ENSORLG00000006570 transcript:ENSORLT00000008249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITSPSASALKNSEICAAWERSSPRNSSSASINKPFLHSAPPSDPLRQARRLHIKVLKML
TARSGHILHPEYLQPLPSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLSSATQN
GSSEKESKSGPLKLSDIGVDDKSSFKPYSKPADKKDSSSGVSGGEKSGFRVPSATCQPFT
PRTGSPNSSTSASPMPSEGKCGDRDEKKDSDCSKNSSADGPGTTSHSRISVSCGGINVEV
NQHQEATPGSKTTSSSESSSVTSVSSASVLGSGLVAPVSPYKPGQTVFPLPPAGMTYPGS
LAGAYAGYPQHFLPHGGSLVNAQLASSLGCSKAGSSPLAGASPPSIMSASLCRDPYCLSY
HCASHLAGATGASCTHDSAAAAAANALKSSYPLMYPTHPIHGVHSSAPSFSGHPLYPYGF
MLPNDPLPHVCNWVSANGPCDKRFSSSEELLNHLRTHTAFTGAEKLISGYPGSSSLASAA
AAAMACHMHMPPSGAPGSPGTLALRSPHHALGLSSRYHPYSKSPLPTPGAPVPVPAATGP
YYSPYALYGQRLTTASALGYQ
Download sequence
Identical sequences H2LQA8
ENSORLP00000008248 XP_004077150.1.28442 8090.ENSORLP00000008248 ENSORLP00000008248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]