SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008337 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008337
Domain Number 1 Region: 111-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 36-92
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 152-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.88e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 1-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000314
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008337   Gene: ENSORLG00000006641   Transcript: ENSORLT00000008338
Sequence length 205
Comment pep:novel chromosome:MEDAKA1:8:9210084:9215015:1 gene:ENSORLG00000006641 transcript:ENSORLT00000008338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLHCGKSFRCFSQLEIHQRSHTGEKPFRCTLCGKRYAQKGHLYTHQRTHTGEKPYRCLVC
GKGFIQKCTLDMHQRTHTGEKPFVCGKCGKGFTKNLKTTKRFECLFCGKIFNYLSSLKVH
IRRHSGEKPFSCSVCGKRFAQKTYLKLHQRVHSGEKPYSCPSCGKSFSQKSSLNIHLRTH
TGEKPYSCVDCGKCYAYKYGLNHHQ
Download sequence
Identical sequences H2LQJ4
ENSORLP00000008337 8090.ENSORLP00000008337 ENSORLP00000008337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]