SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008358 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008358
Domain Number 1 Region: 9-125
Classification Level Classification E-value
Superfamily POZ domain 3.92e-25
Family BTB/POZ domain 0.0000407
Further Details:      
 
Domain Number 2 Region: 476-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 517-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000008358
Domain Number - Region: 452-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00307
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008358   Gene: ENSORLG00000006659   Transcript: ENSORLT00000008359
Sequence length 598
Comment pep:novel chromosome:MEDAKA1:18:14827081:14830726:1 gene:ENSORLG00000006659 transcript:ENSORLT00000008359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRADGYVKEFTRHSNDVLLNLNELRHRSILTDTTLVVGSVQLRAHCAVLVACSGFFYSL
YSRYLLRQLITVSLPNTLDPSCVSLLLDFMYTSRLPLTPSMVSGVLAVAAYLQMDHVADT
CREFMQLHCTETTTAKSLQLELDSRVCFPSVTPKRGDLPSLGLQRSVVENFRNYISLFYC
NSFKVAERDAAAWFCPSANLDHYTTSCVFVYRLPVVQSSFQPGAFLTCQPNSEELKEDHE
SSPKSPACSSCHPNSPAESSTCSKNLVVCPAKSDQSDSTPTPDPKACNWKKYKYIVLNRL
CSPTKVKEETEELQCQASSDANRMNWTPKTPTEACPGEVPSQIDRTQNNNTLKNRKILQG
QASCYEGSGRAPPLGPPPSENQSTHKHELGTHKDPLCSEPKSHLAAFSPNCLHLIQKRTN
LPWNTKATVCPISILAPPQEPDPSHQVKLWPVTLLSDKYLQTGEKPYHCNVCGAQFNRPA
NLKTHSRIHSGEKPYRCDTCGARFVQVAHLRAHVLIHTGEKPYPCHTCGTRFRHLQTLKS
HLRIHTGEKPYSCEKCDLHFRHKSQLRLHLRQKHGAITNTKIRYKVLTEPFQSLLQAC
Download sequence
Identical sequences H2LQL5
ENSORLP00000008358 ENSORLP00000008358 8090.ENSORLP00000008358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]