SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008544 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008544
Domain Number 1 Region: 346-406
Classification Level Classification E-value
Superfamily Leucine zipper domain 2.64e-17
Family Leucine zipper domain 0.00011
Further Details:      
 
Domain Number 2 Region: 21-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000348
Family Classic zinc finger, C2H2 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008544   Gene: ENSORLG00000006799   Transcript: ENSORLT00000008545
Sequence length 501
Comment pep:novel chromosome:MEDAKA1:7:11426321:11434543:1 gene:ENSORLG00000006799 transcript:ENSORLT00000008545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKEGLHSGRLQTDGEVWKMGDEKPFVCGAPGCGQRFTNEDHLAVHKHKHEMTLKFGPART
DSVIIADQTPTPTRFLKNCEEVGLFNELASSFDQDDDEKRAKNSVTANSVALDMSLQTPS
DVKVKEEEAPVEVDSSPPGSPESISGMSDSSQDPIDMPPRNSAPTPAIVRPGSLPLHLGF
DALQPTMPSPTSVITQAPPSNRTLGSPTSHYPMMMLPGGQAVPVLPGPVPSVINLARPMC
MVPNIPGIPGPPLGGSSSGSNSPSGYSNHSEAKMRLKAALSQQSPLGQNMGVMAMGNSAM
VPQKMEQSQLLVQHPDAPSPAQPQVSPAQPTGGRRRRTADDDPDERRQRFLERNRAAASR
CRQKRKLWVSSLEKKAEELSTLNVSLSNEVSLLRNEVAHLKQLLLAHKDCPVTTLQKKNA
YLAAEDGIRDTSEPTGSPAPVIQHSSLAPSPSAGQNGLSSRAAAEAMAMSVLAGMGQQQR
VESGPSHVIMAPGAQQQPSGN
Download sequence
Identical sequences H2LR47
ENSORLP00000008544 ENSORLP00000008544 8090.ENSORLP00000008544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]