SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008611 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008611
Domain Number 1 Region: 38-155
Classification Level Classification E-value
Superfamily POZ domain 9.94e-27
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 510-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000388
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000008611
Domain Number - Region: 487-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000596
Family Classic zinc finger, C2H2 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008611   Gene: ENSORLG00000006852   Transcript: ENSORLT00000008612
Sequence length 640
Comment pep:known chromosome:MEDAKA1:11:15468153:15471278:-1 gene:ENSORLG00000006852 transcript:ENSORLT00000008612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRVRLKDLPPRFMPAPLPHTQRPLMEVGSSSSDASVVQVSFPGAQTSVLDSLNRQREDG
SLCDLSIHVQGQVFKAHRCVLAASSPYFHDQVLLKNMSAVSIPAVMDPLAFESVLSCAYT
GQLRMLRDDIVNYLTVGSVLQMWHIVDKCTELLKEGRAAAGAGTGGGAVQEGAGGAAAAG
SAVDGGRASNTPSYCTPSGGEEALLIEEEEEDMEEEEEEVYHQRKRGRGGGSGRRKKMSS
VSEQEVGVSDSFGVSSYQDGEDAAMPLQKRPTYSQPSIMPRKQWVVVKTERAEDDDLIVV
SEEEGGEDEEEEEEREMELVRERERGNFNISNVRSLSAELGGRPEGDMDSQVDFCQSSED
FFKFEGSLMEQTLAQHLQDSAAGQNQNSNRAVSALLGQVQNASSARAQLFPLDMQGNQIL
LYSQASGLPLDSATSPLGVAGGVMGGGSFKSPNLEHGVVHLQGGLGVDGSDSGGVGAGGG
CGGGSAKVFMCHCGKSFTHKSMRDRHINMHLDLRPFHCPVCAKKFKMKHHLTEHMKTHTG
LKPYDCLGCGKKFMXXXXMWRDSFMRHRSHCERRGGPGESAEGGAGSDGGRRGGGAELLV
QLSSTAQEALAATWLPRGGCWGFPPRVQVRMRDQGCSDSG
Download sequence
Identical sequences H2LRB2
ENSORLP00000008611 ENSORLP00000008611 8090.ENSORLP00000008611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]