SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008652 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008652
Domain Number 1 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 339-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-19
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 3 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.04e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 387-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000054
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008652   Gene: ENSORLG00000006888   Transcript: ENSORLT00000008653
Sequence length 571
Comment pep:known chromosome:MEDAKA1:11:15481577:15489277:-1 gene:ENSORLG00000006888 transcript:ENSORLT00000008653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDSHFNSSYFWSPVPTVQGQIENAMFLNKAKEQLGPEKANGPPFPHSSASSTSSPHFPT
AVLAIPSSVDPGSGVRVVPKQEGGGSGAGVGGNSSGASLSAVGGHLHQSHTSQNVTVVPV
PSTGIMTAAGLVITTPQGTLVPTASTQSFVTGPPSATTMIVSALHPSNTGNPPLQVTTTL
LLPLAVFTFHICTYAAPYTWEWLRIKGFWESVVGDFKEEVCRMCAVTFFSKSDMQIHAKS
HTEAKPHKCPHCSKSFANSSYLSQHIRIHSGAKPYTCTYCQKTFRQLSHLQQHTRNHTEA
KPHKCPHCSKSFANSSYLSQHIRIHTGAKPYSCSFCQKTFRQLSHLQQHTRIHTGDRPYK
CSHPGCEKAFTQLSNLQSHRRQHNKDKPYKCHNCNRGYTDAASLEVHLSTHTVKHAKLFS
CGLCNRSYTSETYLMKHMRKHNPDPLTVAATVAAQQAQGLSTGGGGRGRGRGRGRGGVSG
GGGRGASQLQSQSNPNNTNQNPNPGPPGSYQSTQQPSEAVVQCPFDLHQYKTVAANEIQY
KPVTVADLPVTHKDLCLTVSTSAIQVEHMNS
Download sequence
Identical sequences Q8UUL0
8090.ENSORLP00000008652 ENSORLP00000008652 ENSORLP00000008652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]