SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008698 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008698
Domain Number 1 Region: 10-268
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-80
Family Eukaryotic proteases 0.0000000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008698   Gene: ENSORLG00000006922   Transcript: ENSORLT00000008699
Sequence length 277
Comment pep:known chromosome:MEDAKA1:5:13112451:13114437:1 gene:ENSORLG00000006922 transcript:ENSORLT00000008699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADSDMLRFLLLTSLAALVYLPNSEKIKLKRVVGGQVASPNSWPWQISLQYLSGGSYYHTC
GGSLIQRGWVMTAAHCVDRHCSSRTWRVVLGEHDIYSSGGTEQVIGVSQVYIHPQWDSNR
VANGYDIALLRLSSDATLNSYVQLASLPPSGQILPHNNLCYITGWGLTSTGGSLSSQLKE
AYLPVVDHSTCSRSDWWGSTVKTTMVCGGGGAESGCNGDSGGPLNCQVSGKYYVHGIASF
VSGYGCNYPQKPTVFTRVSAYIDWMNSVSMRKNATVY
Download sequence
Identical sequences H2LRJ9
8090.ENSORLP00000008698 ENSORLP00000008698 ENSORLP00000008698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]