SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008704 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008704
Domain Number 1 Region: 2157-2220
Classification Level Classification E-value
Superfamily Homeodomain-like 1.03e-18
Family Homeodomain 0.0045
Further Details:      
 
Domain Number 2 Region: 2510-2580
Classification Level Classification E-value
Superfamily Homeodomain-like 1.5e-18
Family Homeodomain 0.0052
Further Details:      
 
Domain Number 3 Region: 2827-2896
Classification Level Classification E-value
Superfamily Homeodomain-like 7.27e-18
Family Homeodomain 0.0041
Further Details:      
 
Domain Number 4 Region: 2062-2127
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000197
Family Homeodomain 0.009
Further Details:      
 
Domain Number 5 Region: 2913-2957
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000119
Family HkH motif-containing C2H2 finger 0.00067
Further Details:      
 
Domain Number 6 Region: 1510-1584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000104
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 7 Region: 1368-1415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000158
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 8 Region: 662-703
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000482
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 2244-2266,2409-2436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000561
Family Classic zinc finger, C2H2 0.055
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000008704
Domain Number - Region: 3325-3380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000141
Family Classic zinc finger, C2H2 0.078
Further Details:      
 
Domain Number - Region: 719-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000328
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number - Region: 1003-1034
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000955
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 1889-1923
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0036
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number - Region: 1186-1233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0119
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number - Region: 587-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0256
Family Classic zinc finger, C2H2 0.067
Further Details:      
 
Domain Number - Region: 2594-2618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0817
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008704   Gene: ENSORLG00000006928   Transcript: ENSORLT00000008705
Sequence length 3523
Comment pep:novel chromosome:MEDAKA1:20:11902426:11956982:1 gene:ENSORLG00000006928 transcript:ENSORLT00000008705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSDCSAPATSPVAPAKEIPCNECSNSFSSLQKYMEHHCPSARLPTAGEMGEMNSEMEME
EDSDVENLCGEIIYQPDGSAFILEDSKEQRGNQGGLPGSLQANSGQSGLSPEGERSEQPA
APMSFYPQIINTFHIASSFGSKSLATDHPSFPNTSTGGLVGAGPVLHSFRVYDLRHKNDK
DYLTADGAAKNSCVSKDVPNNVDLSKFEGCVADGRRKPVLMCFLCKLSFGYSRSFVTHAV
HDHRMTLNEKEQKLLSNKHVSAIIQGIGKDKEPLISFLEPKKPPNSVLPHFPSPANFLGP
DAGLRGLWNAFHSSGDNADSLQAGFAFLKGSASSSPTDQTPRTQAMPKAETNPNLGGGAG
AHRTRTGSSAAATGSSLESQNSDSDCKGHVRDTCTLQSNGPDMSHYLPIKREPSTIGEES
PEQDEDAYSVSGVEMEADEEEEQAMSMVVTGQRADSTSSKDFPLLNQSISPLSNSVLKLN
SDSKGPVSTSSSSLPVFEKLEMEKSHLSTALTAVRERESSNDSTSDGLAGRDGLSPSSNP
FDMMMLRRDDESPGPLHQHIGNPSTPGTPGTPGTPVPGEGSPGSGVECPKCDTVLGSSRS
LGGHMTMMHSRNSCKTLKCPKCNWHYKYQQTLDAHMKEKHPESGGSCVYCRTGQPHPRLA
RGESYTCGYKPFRCEVCNYSTTTKGNLSIHMQSDKHLNNVQTLQNGGSEAQYNHNHANHV
PSANLSGGCSAPSPSKPKQKPTWRCEVCDYETNVARNLRIHMTSEKHMHNMMLLQQNMKQ
IQHSLHLGLAPAEAELYQYYLAQNMGLAGVKLENPTGSSGPETQMMINPFQLDPATAAAL
GSGLDPSLSSLSPPISDPLLRLYQCAVCNCYSTDSLEALNAHVSAERSLPEEEWRCVVGD
VYQCKLCSYNTQLKANFQLHCKTDKHMQKHQLVAHIKEGGKANQWRLKCVAIGNPVHLKC
NACDYYSNSVEKLRIHATNQRHESSIRLYKHLQKLDSAYSLESCVYYCNLCDYSTKARLN
LVQHARSARHQQNEGLRKLQLHQQGLGGEEDGLSLHELFHVKECPNIQGESVNKGIMGNE
EELPHATAQVEAAEPSESDGGDSLKPPFLLKNGYNKYGRRDAGFGKVSTSDRQIESPPKR
PKSVEGKTSTNEPVRLYEPKKKTSQQIMPKNINHIFNIFHCFQVQQCPYCNYSSKDANRM
QLHVMSQHSMQPVIRCPLCQDVLSNKIHLQLHLTHLHSVAPDCVEKLILTVVGPDTASPN
NVMHSQTGQEKSPPLMESSTSITDGSGKSLGSMPKDEQASQDKNETDLQGEELKPPKEAS
EAPDWKRTPGIVHDSKSPENLQDHLSELQRLQQQQQQLSVSDRHVYKYRCNHCSLAFKTM
QKLQIHSQYHAIRAATMCSLCQRSFRTFLALRKHLENGHPELTEAEVQQLIGNLPLNGDI
TESEARALEEAQAFEHDLDKDDEMDQEEKPSPTGSDSSSLLDDMGSEPKRTLPFRKGPNF
TMEKFLDPSRPYKCTVCKESFTQKNILLVHYNSVSHLHKLKKVLQEASSPVPQEPTNSID
NKPFKCNICNVAYSQSSTLEIHMRSVLHQTKARTAKSETNSCSTTSSSGPAPTKSPGPST
QGNTSNVDTARSGTPSSNKDNAAEPKEPNNSNTKQASTTDHVTAQASSHQSAQSSAQLQL
QLQHELQQQAAFFQPQFLNPAFFPHFPMTPEALLQFQQPQFLFPFYIPGAEFNLNPELAL
HSAAAFGMPGLTGSFLEDLAQTQSQIHQQKNQQMQQLQNQKSKLDSSTISISELQMPRDT
DDLLEKLENRAKMENAGDAISDGGKDNRDSKKSNFPEPLIPPPRIVSGARGNAAKALLEN
FGFELVIQYNENRQKSQKKNRDGTDQVETNTDKLECGMCGKLFSNMLILKSHQEHVHSHF
FPYVELEKFAQQYREAYDKLYPINPSSPPPSTPISKPQTPVPSPVSVPHQTVHQPSHQTT
PQPPPPPPPSAAPPAPPQVQLPVPLDLPLFPPLMMQSVQHPGLPPQLALQLPTMDSLSTD
LTQLCQQQLGLDPNFLRQSQFKRPRTRITDEQLKILRANFDINNSPNEEQIQEMSEKSGL
PQKVIKHWFRNTLFKERQRSKDSPYNFNIPPITTLEDIRMESQLSSQEYYRSDSGINKRS
SRTRFTDYQLRVLQDFFDTNAYPKDDEIEQLSTVLNLPTRVIVVWFQNARQKARKSYENQ
ADSKDCEKKELTNERYIRTSNMQYQCKKCNIVFPRIFDLITHQKKLCYKDEDEEGNEDNT
CEEYIDTDQCLTKHNQLSSDPSKHYHAGTASSSGSTSPVMASPRGPMGKTSPKPDIPSET
ELKQADTASSPIIKSLPEPRPSKACTPQPPPQKTPQPQLSRPHSQPQAAAVPSSPLSMAL
SSLTNSLPHQMLQYQCDQCKIAFPTVELWQEHQHMHFLAAQNQFLHSQFLERPIDMPYMI
FDPNNPLMASQLLSGGLTQIPSQGSSSMASAAASAAMKRKLDDKEENGNDKDGGNSGEEQ
HRDKRLRTTITPEQLEILYDKYLLDSNPTRKMLDHIAREVGLKKRVVQVWFQNTRARERK
GQFRAIGPSQSHKKCPFCRALFKAKSALDSHIRSRHWHEAKQAGFSLPPSPMMNQDNERG
ESPHKYGFFDHTQLPTKTEQNDYELPAASSTPVKPSETQIKNFFSPSSIKAENCDETEGP
NNNSAEASTYDLSKMDFDETSSINTAISDATTGDECNNNEVENLTANGGDKLNDSKSGLM
PNSEGGNERFQFSMVSPALSFSGKDCDSYYSSRDDDMDDTNDRSESSSLADPSSPSPFGA
GNPFSKSGKVNSAGDRPGHKRFRTQMSNLQLKVLKACFSDYRTPTMQECEMLGNEIGLPK
RVVQVWFQNARAKEKKFKINIGKPFMISQGSPEGPRPECTLCGVKYTARMSVRDHIFSKQ
HITKVQETLGNQVDREKDYLAPTTVRQLMAQQELDRMKKAGEGLSLPGQQQQTSVDSSNA
LHGLSLPTGYPGLSGLPPVLLPGVNGPSSLPVFPPNTPALASPGAGMLGFPTPATPSPAM
SLSTTPTKTLLQVPSTSLAAVNHTEQQGKDSERDSSKKPGAMQSQMKAKDRENESGSRPE
TPSMAKKREKPCPAPGKPGSETALDATQLQALQNALATGDPSSLLGGQFLPYFLPGFPNC
FSPQLPRGVQTGGYFPPLCGMESLFPYGPAVPQAAMAAGLSSTALLQQYQQYQQSLQDSQ
QAPVKTPHGIQSTTATSFKEKQAIDAKDDNNKGSSTESTKEERKTDTKSTMDFPDAFIVP
SVKHEFICRKCQMIFADEDSVVRHQKSFCYFGHPFTDLQDTVLRKAVSNYTCVACNVVVD
GNEALGQHLQSSLHKEKTIKQAMRNAKEHTRLLPHSVCSPTPNTTSTSQSAASSNNTFPH
LSRLPMKSWPNVLFQATTARKAASSSPSASPPPPLSSPSTVTSTSCSTSGVPTSLPTESC
SDESDNELSQKLEDLDNALEVKAKPASVLDASFSSIRMDMFSV
Download sequence
Identical sequences H2LRK5
8090.ENSORLP00000008704 ENSORLP00000008704 ENSORLP00000008704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]