SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008748 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008748
Domain Number 1 Region: 67-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 403-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 179-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-20
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 6 Region: 291-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 235-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 504-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 29-80
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.19e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 10 Region: 122-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008748   Gene: ENSORLG00000006966   Transcript: ENSORLT00000008749
Sequence length 557
Comment pep:novel chromosome:MEDAKA1:17:10878122:10880101:1 gene:ENSORLG00000006966 transcript:ENSORLT00000008749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDQPQICEEVQTDQYICNQRRNTNMNGKSLSCNVCGKNFKYNSHLKRHLMIHSGERPYSC
ESCGKGFRQSSDLTVHMRIHTGETPHHCKVCGKGFSVTSVLKIHMRTHTGERPYSCETCG
KSFTSSSSLTIHRRCHTGERPHSCTSCEKAFSCSKALTIHMRTHTGHRLYFCETCSKGFS
CNQSLKIHMRIHTGEKPFTCTICRKSFRHKGSLSLHMKVHSGKKTFSCKLCGKGFFIESR
LTDHMRIHTGEKPFSCKTCHKSFSCNQSLTAHTKVHSSERPYSCEKCGKRFRHSGSLTFH
LKTHSGQKPFSCEVCGKHFIASRALTVHMRTHTGERPFSCTTCSKSFSLKCILKDHMTTH
SGERPFSCQTCGKSFSLKRSLQVHVKTHTGEKPYFCEMCGTRFRTKHSIDAHMRIHSGER
PFSCQTCAKSFTNKSSLTIHMRMHTDSRPYRCTTCGKSFNKTYALTVHKRTHTGEKPFPC
DLCGKAFTRSSGVTNHMRVHTGSRPFVCGTCGKSFKSSSNLTVHTRSHTGENPYVCNTCG
KSLSCGSSLKAHMRIHT
Download sequence
Identical sequences H2LRP7
ENSORLP00000008748 ENSORLP00000008748 8090.ENSORLP00000008748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]