SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008808 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008808
Domain Number 1 Region: 368-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 146-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-23
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 34-91
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-22
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 647-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 479-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 591-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 8 Region: 91-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 9 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 10 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-20
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 11 Region: 269-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 12 Region: 1-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000434
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 13 Region: 192-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000943
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000008808
Domain Number - Region: 250-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0278
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008808   Gene: ENSORLG00000007009   Transcript: ENSORLT00000008809
Sequence length 713
Comment pep:novel chromosome:MEDAKA1:17:10960275:10989822:-1 gene:ENSORLG00000007009 transcript:ENSORLT00000008809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVCGKAFKKKSLITQHVIIHSGEKPFDCKTCGKSFSRSGNFTIHMRTHTGEKPFSCETCG
KSFTDSYSLTIHTRTHTGERPYSCKTCGKRFSRSCNLTIHTRTHTGERPYSCETCSKSFT
ERYSLTIHRRTHTGERPYSCETCGRSFNCNSSLTAHTRTHTGEKPYSCETCAKRFSRRSN
LIVHMRTHTDEKPYSCNLCDKSFTRREGWLIHKQIHSCEKSYSCKICGKTFSQSCGLTVH
MRSHMTEKINKCQSAFIKDFNFSTQMKKHTEEKNYSCEICGKDFTVSSRLTVHMRTHTGE
RPFLCKLCGKTFKHSGSLKAHTRTHTGEKPFSCEICGKSLMKNSSLKDHMRTHTGERPFS
CEICAKGFVKNSSLRDHMRIHTGEKPFSCKTCGKAFTQNSTLQHHMRTHTGEKPFSCKIC
GKAFFQPYILTNHMRKHTGERPFSCETCGKCFFQPYSLTNHMRIHTGERPFSCDICGKAF
TQSGSLQHHVKIHTAQRPFTCDTCGKAFTQNSTLQHHMRTHTGERPYSCTLCGKSFSRND
SLTSHVKTHTSERPFSCEQCGKRFIKSGSLKVHMKSHTDERPFFCEICGKSFNRNASLNI
HRKSHTGEKLYFCKTCGKRFFTSSSLTVHMKTHTGERPFSCETCGKSFNLSWSLKAHMRT
HTGERPFSCIICDRSFTCSSTLKAHVRTHTGERPFTCKMCGKGFKRNASLEAH
Download sequence
Identical sequences H2LRV3
ENSORLP00000008808 8090.ENSORLP00000008808 ENSORLP00000008808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]