SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008825 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008825
Domain Number 1 Region: 20-61
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000194
Family Classic zinc finger, C2H2 0.05
Further Details:      
 
Domain Number 2 Region: 125-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000437
Family Classic zinc finger, C2H2 0.07
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000008825
Domain Number - Region: 231-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000238
Family HkH motif-containing C2H2 finger 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008825   Gene: ENSORLG00000007023   Transcript: ENSORLT00000008826
Sequence length 433
Comment pep:novel chromosome:MEDAKA1:12:11713216:11715161:1 gene:ENSORLG00000007023 transcript:ENSORLT00000008826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAEDHKDTSLASPASQEEDEEVVAEGSNKFYCYLCSITCHNQQNFRSHMNSISHQQRMME
IQYMSNACLVTLLPRVQESLQGANKDGDKKSESKRWCATCHSHFTCSTTEHRCSEEHKLA
TATNVSFCIVCKKQFKTSQNFLEHLHSQGHKQKLQEKGCDALVKLTALDTVEFSLENEEE
GGGGGETDTEGNQRDTQDDWSSLKEVTLNDISRDEQYDPDTVYGSSFLVPVAGFICKLCN
KFYYFDSSAAHTHCKSLKHFENLRSYRESVIQKGEGSQSSRKSSAAADSGGTATQSSTDC
SEEKLLSVEKDVAPNLNSLQSIISVNRPKEKQPAETDSNSQDLTISTLSSGSPDEAVCTQ
HRDEENTPYASAALESEADLPRSSTEEADSEPAAAAENSNDEDEAPAGPGKKNGTGKART
APKRRSGRATNRR
Download sequence
Identical sequences H2LRX0
8090.ENSORLP00000008825 ENSORLP00000008825 ENSORLP00000008825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]