SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008834 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008834
Domain Number 1 Region: 80-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 472-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-23
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 136-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-22
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 640-696
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 527-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 584-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.35e-21
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 695-752
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.55e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 737-789
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 12 Region: 42-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 13 Region: 212-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000115
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 14 Region: 429-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000585
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 15 Region: 1-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000595
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008834   Gene: ENSORLG00000007032   Transcript: ENSORLT00000008835
Sequence length 795
Comment pep:novel chromosome:MEDAKA1:17:11001337:11023629:1 gene:ENSORLG00000007032 transcript:ENSORLT00000008835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STLERHCQRNTEENSVQCSVCGKTTHSLGKQSQRKQLDLDERSHSCETCGKVFTRRGSLI
THMRIHTGERPYSCKTCGKSYIQRGDLTVHMRKHTGEKPFTCEMCGKSFTQSSRLVVHMR
GHTGEKPFNCEICGKSFNRSGSLTAHLRTHTGERPFSCKMCEKGFTQSSNLAAHMRTHTG
ERPFSCDLCPKSFKTKTSLSFLNLHIDESSNSCDSCFFQSNNLKAHISIIHTGEKPFTCE
VCEKSFTTSSNLKAHMRTHTGEKPFICSVCQKSFLTNTEIKIHLRTHTGERPFSCEICER
SFTTSSHLNVHLRSHTGERPFSCEVCQKSFLTSVELKVHLRTHTGERPFSCKVCEKSFTT
SSTLNVHMRTHTDERPFSCIVCGKGFIQSSHLKAHMITHTGEKPFSCKVCQKGFSRSSSL
KVHMKKTSHTDESPFSCETCRRSFTTQTHSKGHMLTRTNESSHSCDTCGKQFIQRGHLTI
HMRTHTGERPFTCEVCEKSFITNSNLKAHMRTHTGEKPFNCKVCPKSFLTRSEMKIHLRT
HTGEKPFLCKVCERRFTTSSALNVHIRTHTGERPFLCEVCQKGFLTSSEMKIHLRTHTGE
RPFSCKLCEKSFTTRTVLNVHIRTHTGERPFSCEVCSKIFTTSNALKIHMISHTGERPFS
CIVCGKSFIRSSHLTAHLRTHTGEKPFSCEICQRSFTTSSHLNVHLRSHTGEKPFSCELC
QKSFLTCAELKVHFRTHTGEKPFTCKVCEKSFTTSSCLRVHMRTHTHEKPFTCTLCEKSF
SRSSSLKIHMKNHVG
Download sequence
Identical sequences H2LRX9
ENSORLP00000008834 8090.ENSORLP00000008834 ENSORLP00000008834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]