SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008922 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008922
Domain Number 1 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000216
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 85-212
Classification Level Classification E-value
Superfamily SET domain 0.000000000000262
Family Histone lysine methyltransferases 0.028
Further Details:      
 
Domain Number 3 Region: 244-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000627
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008922   Gene: ENSORLG00000007114   Transcript: ENSORLT00000008923
Sequence length 363
Comment pep:novel chromosome:MEDAKA1:12:11796682:11799874:1 gene:ENSORLG00000007114 transcript:ENSORLT00000008923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSVLPADTLTLKSGFKCPGRALSDVITSDILHSFLYGRWRNVLGEHLAEERHSASVST
KTAFTAEVLAQSFAGEVQKLSSLVLPSEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTG
RLLSPEHVDLLKNNNLMWEVFNEDGTVRYFIDASQEDQRSWMTYIKCARNEQEQNLEVVQ
IGSSIFYKAVETIPPDQELLVWYGNTHNTFLGIPGVPGTDEEHHKKNRNDDSHALDNTTT
SGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPY
KCHVCQSAYSQLAGLRAHQKSARHKPASPGVADAAPQASPPPQQMTARAHQMPLVRHIPT
VVL
Download sequence
Identical sequences H2LS62
ENSORLP00000008922 ENSORLP00000008922 8090.ENSORLP00000008922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]