SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009045 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009045
Domain Number 1 Region: 125-368
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.69e-85
Family Eukaryotic proteases 0.00028
Further Details:      
 
Domain Number 2 Region: 41-131
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000405
Family Scavenger receptor cysteine-rich (SRCR) domain 0.095
Further Details:      
 
Domain Number 3 Region: 12-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000641
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009045   Gene: ENSORLG00000007210   Transcript: ENSORLT00000009046
Sequence length 372
Comment pep:novel chromosome:MEDAKA1:13:14554486:14561005:-1 gene:ENSORLG00000007210 transcript:ENSORLT00000009046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQLNNPSVSVSDTCPNNTVQCDGISDCELGSDETKCVKFGADNRLLVQTAQNSAFLPVC
YSGWSTDDAVKVCRQIGFYGDSVSGELSSQNSEVLEVTSNSASRIQSRVNVSSSCPNAKI
VSLSCIDCGRQPSTSRIIGGTIAKAGQWPWQLSLHYGRSHVCGAVLISREFALTAAHCFP
SSMGTSPSNWKVYGGIVSLNQLPSPYMVKKIILNKNYNSNTNDQDIALIQLASPVTLTDN
VQPACLPLSENPTINCWTTGFGTTSEGSATVSTNLMEVKVDIISNSVCNTRAVYGPGAVT
NNMICAGNLSGGKDSCQGDSGGPLVCQGQSRWHVVGLTSWGAGCGRENKPGVYTNVNSFL
PWIYGAMKEAAS
Download sequence
Identical sequences H2LSI1
8090.ENSORLP00000009045 ENSORLP00000009045 ENSORLP00000009045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]