SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009048 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009048
Domain Number 1 Region: 375-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 336-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 416-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000017
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009048   Gene: ENSORLG00000007212   Transcript: ENSORLT00000009049
Sequence length 476
Comment pep:novel chromosome:MEDAKA1:14:15176363:15177872:1 gene:ENSORLG00000007212 transcript:ENSORLT00000009049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKTMTSRRAGFGADSSPRKQSISDRVEACFDRKADKYPQSSVTVTSLKSRLAPTIQTAMS
AAVDTLLGEVVVVLSETQQELFHKEQENERLKVRLEVSERELKNLQECLCSAQKLIDQLQ
VSFPGPQAVSQSVFAPSLSSMASMTSGLDRDQQNPRGVNGAGVDLGLGGSVEESLHGFEH
RDDFKMCQLSIQPDGSVTNHTLDSFGSPHLCPDSSRPEERQPQGPGGPHRFEIKEEQGPS
PGQPSKREAGLSSEGRDVERSSLTMGDINYAQGGGTHPLRHQRAVRGCGSSLQQGRPDGP
QKPLPRTSVSRSSPGRAEDSAGPSAPDTAGEPPGDRPHHCLECGKTFRLISSLKKHIRIH
TGEKPYPCGVCGRRFRESGALKTHLRIHTGEKPYSCSECGNCFRHLDGLRKHRRTHTGEK
PYVCAICGKRLSRLQHLKHHQLIHTGERPCCCPFCNRTFKEPAALRKHIRTHREEG
Download sequence
Identical sequences H2LSI4
ENSORLP00000009048 8090.ENSORLP00000009048 ENSORLP00000009048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]