SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009056 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009056
Domain Number 1 Region: 181-444
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.85e-81
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 104-205
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000196
Family Hepsin, N-terminal domain 0.048
Further Details:      
 
Domain Number 3 Region: 57-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000576
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009056   Gene: ENSORLG00000007221   Transcript: ENSORLT00000009057
Sequence length 448
Comment pep:novel chromosome:MEDAKA1:13:14590811:14594682:1 gene:ENSORLG00000007221 transcript:ENSORLT00000009057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFQTPDLNQYPGNKTISMKPLATCKEKALKRKKLLLTIILVVVILVILCVTGYFVWKLIK
SKYFFCSSSVKFIPIEKACNKQNDCSDGEDEKDCVLNFAVNTTFPVRLASSQNILQVYSE
SSGWSSVCSNEWTQQHTETACEQLGYTRSSLTLCKLCSNRNPTSTYIQVTSLTSSLKISY
CFPTCSSVCRSGSVVSLTCSDCGMSKREPFPRIIGGNETDIKDYPWQVSLQNNGQHTCGG
SLVSPRWVVTAAHCFNGNNKVISRWTVMSGHSGMTTAGASYVDKILVNNDYRPEKQDFDI
ALIRLSSPITVRDYQKPVCLPPKDLGLANQSPLAVTGWGYREEEGEKTFCLLLQEADVPL
IDWTTCSSSSLYGSFLTRRMICAGYTEGKVDACKGDSGGPLVYFLPHQWTLVGVVSWGIG
CARANKPGVYTNVDEMLNWIHTTIEVFF
Download sequence
Identical sequences H2LSJ2
8090.ENSORLP00000009056 ENSORLP00000009056 ENSORLP00000009056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]