SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009082 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009082
Domain Number 1 Region: 331-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 364-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000223
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009082   Gene: ENSORLG00000007242   Transcript: ENSORLT00000009083
Sequence length 452
Comment pep:known chromosome:MEDAKA1:16:12829731:12831445:1 gene:ENSORLG00000007242 transcript:ENSORLT00000009083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSLLGEEPRLGSTPLAMLAATCNKIGSPSPSPSTISDNSSSFGKGFHPWKRAAASSCS
LGSGLSGFGVSRNGSGISDSFGTNSSTGSSAFSLTSGTSSSSHFGNDYSVFQASVSSNSQ
ESNHQPVFISKVHTSVDSLQGIYPRMSVAHPYDSWFKSSHAGIPAGEVGTTGASAWWDVG
AGWIDVQNPNGAALQTSLHSGGLQTSLHSPLGGYNSDYSSLSHSAFSTNPSPHLLTTGQH
LMDGFKPVLSSYPDTSPSPLTGAGGTMLSAGPPASLAGSPRSSARRYSGRATCDCPNCQE
AERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTR
SDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHVKTHSAGGSAGSGSGGSGGKRGSDT
DSEHSAPGSPPCHSPDLLHPPESNQAVGMNGL
Download sequence
Identical sequences H2LSL8
XP_011483456.1.28442 ENSORLP00000009082 8090.ENSORLP00000009082 ENSORLP00000009082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]