SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009109 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009109
Domain Number 1 Region: 42-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.96e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.18e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 322-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 210-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-19
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 157-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 451-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.48e-18
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 7 Region: 5-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-17
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 8 Region: 266-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 83-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000607
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 369-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000131
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009109   Gene: ENSORLG00000007263   Transcript: ENSORLT00000009110
Sequence length 510
Comment pep:novel chromosome:MEDAKA1:17:11980535:11990553:-1 gene:ENSORLG00000007263 transcript:ENSORLT00000009110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AESAYFCHECGKCFNQRGSLKVHMRTHTGEKPFSCSHCGRRFTRSGDLSSHMRTHTGEKP
FSCQICGKSFSQSCNLLCHLRTHTGEKPFTCPTCGRKFNRRNNLKTHMKAHCLEQLKKTN
KCIFSFNPFKNRHHDCRKKKTSKNKYLCTVCGKHFARHSLIAHRRIHNGEKPFACETCGK
RFTQRGNMLLHTAVHTAEKPYSCDTCGKKYSRNESLLRHNRTHTGERPFTCKTCGKGFAR
SEVLSAHMSSHSDERPFACKTCGKRFSLRNTLATHMKGHTGHKAFSCKTCGKQFTRKCSL
LLHTKIHTGEKLFACKLCGKRFRQKSHMLGHVRTHTGEKPYLCKTCGKTFGNSTLLLRHI
RTHTGERRYSCKLCGKKFKQSGSLGVHMKTHAGEKPYSCGTCGKTFSRQDNLTEHLKIHT
GERPFSCETCGKRFSRKRCLSSHMRIHTDQRPFLCKTCGKRFRQISVLTCHTRIHTGEQP
YLCKICGRRFSRSGNLSQHLRVHTGEKPFS
Download sequence
Identical sequences H2LSP4
ENSORLP00000009109 8090.ENSORLP00000009109 ENSORLP00000009109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]