SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009221 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009221
Domain Number 1 Region: 39-96
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.43e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 95-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 193-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 5 Region: 1-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.92e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009221   Gene: ENSORLG00000007354   Transcript: ENSORLT00000009222
Sequence length 260
Comment pep:novel chromosome:MEDAKA1:17:12595728:12596527:-1 gene:ENSORLG00000007354 transcript:ENSORLT00000009222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCYICQECGKSFCNKSQFRIHTRIHAEGKQFSCKECDKSFSRVSSLKAHMRTHTGEKPFS
CKECDKSFRCVSTLKTHMRTHTGEKPFSCKECKKSFSDASALKTHIRTHTGERPFSCKEC
KKSFSQISHLKSHMRTHTGEKPFSCKECDTSFRHAACLKIHMITHTGGKPFSCKECKKSF
NQISNLKTHMRTHTGEKPFSCKECKKSFCQLSTLKIHMRTHTGEKPFSCKECDTCFRHAT
SLKRHMRIHTVKNVKKILVM
Download sequence
Identical sequences H2LT04
ENSORLP00000009221 8090.ENSORLP00000009221 ENSORLP00000009221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]