SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009270 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009270
Domain Number 1 Region: 385-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000124
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 847-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000576
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 1054-1106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000936
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000009270
Domain Number - Region: 961-983
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0811
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009270   Gene: ENSORLG00000007396   Transcript: ENSORLT00000009271
Sequence length 1114
Comment pep:novel chromosome:MEDAKA1:1:22176651:22217390:-1 gene:ENSORLG00000007396 transcript:ENSORLT00000009271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPRLKLNPPRRTRCHDVDGNEDGGPNGGVEEEDGWFGNASDTRSESSSFGDTQDELLLHR
GLSPDGDHDTCGGESSMGCPTPVHRASLELLGLDGGAFSAQDTLSSVVSSLYGEAASRAL
GKPLSSNLRRLLEAGSLKLDTGEEVQGENPPPIALAPSLTLSPSSHHAQQLSALARKLAN
NNNSGSAFTPSNGSGFVWAGVTDKWPPATCSNPCGSSLSPDSAIQKLKAAANAVLQDNGG
SRGDDMVRFDAFNSPFSPQSASSTLAALSKKVSERSQASSTASAASDHQASANSFLSLVS
MTSSAALLKEVAARAAGNLLAEKKEGSPLAAAGVLQEDAKPLLDMNRKAPTPSTPNQNLE
LLLPSTPKARGKPNNQAGSPEDGGKPFQCPVCGLVIKRKSYWKRHMVIHTGLKSHQCPLC
PFRCARKDNLKSHMKVHQHQDRGETFQCELCPFTSSRHFSLKLHMRCHQHFPRTDVKVKE
ELTTDTEGEGSLLGDSGSTDPRATQVSPLTSDIQQATSSPVEASGNHVHIKEEPQERDLS
VLSPFSMCRDRPSSSANSLDIPGVGVGVRSSPSGPTAASLFSPDITTKTATDLLMKLSAA
NQRETLQSPFHLKEEPKAEEAPSPRPSSRSHNQAQPSFPASFCQDGAAAATERPGSLKTR
EGSPIAKNSLLSQDINVKVASELLIKLSENNKDAQYQKVKVKVKVKAEPMEVDPPPVELT
SPGSHLLPFSTLGASEKNEPMSSLPDTLACNQKDLFSQDISVKMASELLFKLSEKVSKAN
NHKDSNMVGIHSPFLDECFRQSPFNSRSKSSSPAEASSSTRVLFHDSEKDDGEPGNGISQ
WRLHEQLFPCPVCGKVFGRQQTLSRHLSLHTEERKYKCHLCPYAAKCRANLNQHLTIHSV
KLVNTDAEQIVSAVTAESAERKNYPYYYSCHVCGFQTELNAQFVSHMSLHVDKEQWMFSL
CCSTCDYICMEESDMKSHISAGHAALNSRSPLSETKSTSSSLSALSDSLNSSEGGDITHG
NEELKSLLAPPSSAGNQAGSGSHLGSGTEDKSDKGFECVFCNFVCKTRSMYERHLQIHLI
TRMFECDVCHKFLKTPEQLLEHKKCHTVPSGGLK
Download sequence
Identical sequences H2LT52
ENSORLP00000009270 8090.ENSORLP00000009270 ENSORLP00000009270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]