SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009271 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009271
Domain Number 1 Region: 299-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.36e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 237-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 200-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.9e-17
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 412-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.45e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 479-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000154
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 349-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000773
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000009271
Domain Number - Region: 162-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0333
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009271   Gene: ENSORLG00000007397   Transcript: ENSORLT00000009272
Sequence length 527
Comment pep:novel chromosome:MEDAKA1:15:21567777:21569474:1 gene:ENSORLG00000007397 transcript:ENSORLT00000009272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGIKTEVAGLECVLMAESETECDTPGLDTLGSECVIAHSHVDLHYGAETEIMTEEKRGLE
LEIHGGDLKIQGLGTELGAVTCVEAIVAESDHDYIKVEPADMHCFTAAEIKTTGTETLLG
EVLLKTDSEHMVKVESDHGGELTVESENGVIIHEAHGLQCNDESFAVEASLKQHMKIHMK
EMPYVPPGVEIMGKDVIDAFSLKSHQMIHLTDKPHRCSECGKSFAAAITLREHMKMHSED
KPYKCTQCRKSFVRRRHLKKHQEVHAREKPYTCGQCGKGFATTSNLKQHQKTHAAVVLGD
KPHRCAQCGKCFAAAATLREHQRVHSGEKPYKCNMCRKSFVRKRHLKKHQQVHAGGKPYT
CRHCNKGFNHSSSLSRHHKTHLQNPVFSPPLPGKPMSYATPPKQRVLQEGEKPYMCHFCA
KGFNHSSSLSRHQRVHSEGKSYTCGHCGKTFTHSSSLARHQRVHLENPQTPQPQSPQYVT
IHTGKAFPNNAFSKQHTPTSEKRYRCSQCGKGFNHSSSLSRHHRIHV
Download sequence
Identical sequences H2LT53
ENSORLP00000009271 8090.ENSORLP00000009271 ENSORLP00000009271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]